(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE201

CP002209.PE201       Location/Qualifiers
FT   CDS_pept        222121..222585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_0155 hypothetical protein; SPTR:
FT                   A2V2I8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74415"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL21"
FT                   /protein_id="ADN74415.1"
FT                   /translation="MFLVSNFPNVPIATSNPATESAQREAALRVPISRPEPLLKSAAER
FT                   ALDPERERSRIDPRQQSQQRQSGEEQEQSDQPPPQQGREGPLSWREALAQARPVMERPG
FT                   SRRSHVASSVDHHPAQDLDKAAYARFEQIVRHHYEGVAEPRTPPAFEART"
     atgttcctgg tttccaattt tcctaatgtc cctatcgcca ccagtaaccc ggccacggag        60
     agtgcgcagc gggaggcggc gttgcgggtg ccgatcagcc ggccagagcc gttgctcaag       120
     agtgcggcgg agcgggcgtt ggatccggaa cgggagcgca gtcgcatcga tccacgccag       180
     caatcgcaac agcggcagtc cggtgaggag caggaacaga gcgatcagcc tccgccgcaa       240
     cagggccggg aagggccact gagctggcgc gaggcgttgg cccaggcccg tccggtgatg       300
     gagcggccgg gaagccgtcg cagccatgtc gccagcagcg tcgaccacca tcccgctcag       360
     gatctggata aagcggctta cgcccggttt gaacagattg tccggcacca ctatgaaggg       420
     gttgccgagc cccgcacgcc ccccgctttc gaagcccgca cttaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page