(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE206

CP002209.PE206       Location/Qualifiers
FT   CDS_pept        complement(225475..227802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0206"
FT                   /product="Tex-like protein"
FT                   /note="COGs: COG2183 Transcriptional accessory protein;
FT                   InterPro IPR003029: IPR018974: IPR006641; KEGG:
FT                   ecf:ECH74115_4713 putative transcriptional accessory
FT                   protein; PFAM: Tex-like protein-like; RNA binding S1 domain
FT                   protein; SMART: Resolvase RNase H domain protein fold;
FT                   SPTR: A2P4I2 Putative uncharacterized protein; PFAM:
FT                   Tex-like protein N-terminal domain; S1 RNA binding domain;
FT                   TIGRFAM: glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type; competence
FT                   protein ComEA helix-hairpin-helix repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74420"
FT                   /db_xref="GOA:E1SL26"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL26"
FT                   /protein_id="ADN74420.1"
FT                   /translation="MEPISHLIAQELGVRPQQVQAAITLLDDGATVPFIARYRKEVTGT
FT                   LDDTQLRTLETRLGYLRELSDRRQSILKSIDEQGKLSDSLRAAIEAADTKTALEDLYLP
FT                   YKPKRRTKGQIAIEAGLLPLADSLFENPSQDPEQSASAYLNAEAGFDTTKAVLDGARAI
FT                   LMERFAEDATLLAKIRQHLQQNAHLKSQVISGQESNGAKFQDYFDHAEPWAKVPSHRTL
FT                   AMLRGRNEGVLALSLEADPNKEEGDRSSYCEQIIAQHFAIPTGNQPGERWLQQLCQWTW
FT                   RVKISLAMETELLGDLRERAEADAIKVFAENLSDLLMAAPAGMRPTLALDPGLRTGCKV
FT                   AVVDGTGKLVATDTIYPHAPQKRWNDALTVLAKLVNQHQVELIAVGNGTASRETDKLAG
FT                   ELIKALKKPGLTKVMVSEAGASVYSASETAALEFPTLDVALRGAVSIGRRLQDPLAELV
FT                   KIEPKSIGVGQYQHDVSQTQLARSLDAVVEDCVNGVGVDLNTASVPLLTRVAGLSRTLA
FT                   QNIVQFRDEHGRFTNRKQLLKVARLGPKAYEQCAGFLRIAGGDNPLDGSGVHPEAYPVV
FT                   KKISAHTGVAVAELVGNSGVLQSLRAGDFTDERFGLPTVNDILKELDKPGRDPRGQFET
FT                   AAFAEGVEKVSDLEPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALSNKFVEDPRTV
FT                   VKAGDVVKVKVMEVDVPRQRIGLSMRLDDQPGEARSQRSGGQDRPTRQPRKESRPARQS
FT                   DPAGGGLSGAFADAFANAKKRR"
     atggaaccga tttcacacct tatcgcccag gagttgggcg tccggccgca acaggtacaa        60
     gcggccatca ctctgctcga cgacggcgcg accgtgccct ttattgcccg ttaccgcaaa       120
     gaggtgaccg gcaccctcga tgacacccag ctgcgcaccc tggaaacccg actcggttac       180
     ctgcgtgaac tgtctgatcg tcgccagagc atcctcaaat ccatcgacga gcagggcaaa       240
     ctgagcgaca gcctgcgggc ggccatcgaa gcggccgaca ccaagaccgc actggaagac       300
     ctctacctgc cttacaaacc caaacgccgc accaaagggc agatcgccat cgaggcgggt       360
     ttgctgccgc tggccgacag cctgtttgag aaccccagcc aggacccgga acagagcgcc       420
     agcgcctacc tcaatgccga ggccggtttc gacaccacca aggccgttct ggacggcgcc       480
     cgcgccatcc tgatggaacg ctttgccgag gacgccaccc tgctggccaa aatccgccag       540
     cacctgcagc agaatgccca cctgaagagc caggtgatca gcgggcagga gagcaacggc       600
     gccaagttcc aggattactt tgaccacgcc gagccctggg ccaaagtgcc ctcgcaccgc       660
     actctggcaa tgctgcgcgg ccgcaacgag ggggttctgg ccctgtctct ggaggccgac       720
     cccaataaag aggagggtga ccgcagctcc tactgcgagc agatcatcgc ccaacacttt       780
     gctatcccca ccggcaacca accgggtgag cgctggctgc agcagctgtg ccagtggacc       840
     tggcgggtca agatcagtct ggcgatggaa accgagttgc tgggtgacct gcgtgagcgc       900
     gccgaagcgg acgccatcaa ggtgtttgct gagaacctct cagacctgct gatggccgcc       960
     ccggccggca tgcgccccac cctggccctc gaccccggcc tgcgtaccgg ctgcaaagtg      1020
     gcggtggtgg acggcaccgg caaactggtg gccaccgaca ccatctaccc ccacgccccg      1080
     caaaaacgct ggaatgacgc cctcaccgtc ctggccaagc tggtcaacca gcatcaggtt      1140
     gagctgattg ccgtgggcaa cggcaccgcc tcgcgggaga ccgacaagct ggccggtgaa      1200
     ctgatcaaag cactgaagaa gccgggcctc accaaggtga tggtgagcga agcgggcgcc      1260
     tcggtgtact ccgcttccga aaccgcagca ctggagttcc caaccctgga tgtggctctg      1320
     cggggcgccg tttccatcgg ccgccgcctg caggacccgc tggcagagct ggtgaagatt      1380
     gaacccaagt ccatcggcgt cggccagtac cagcatgacg tcagccagac ccagctggcc      1440
     cgttccctgg atgcggtggt ggaagattgc gtaaacggcg tcggggtcga tctcaacacc      1500
     gcctcagtgc ccctgctgac ccgggtggct ggcctcagcc gcaccctggc gcagaacatt      1560
     gtccagttcc gcgatgagca tggccgcttc accaaccgca agcagctgct gaaagtggcg      1620
     cgcctcggcc cgaaagccta cgaacagtgc gccggcttcc tccgcatcgc cggaggcgac      1680
     aatccactgg acggctccgg cgtgcacccg gaagcctatc cggtggtgaa aaagatcagc      1740
     gcccacaccg gcgtcgccgt ggcggaactg gtgggtaact ccggtgtgct gcaatccctg      1800
     cgcgccggtg actttaccga cgaacgcttc ggtctgccca ccgtcaacga catcctgaag      1860
     gagctggata aaccgggacg cgacccccgc ggccagttcg aaaccgccgc ctttgctgaa      1920
     ggggtggaga aggtgtccga tctggagcct ggcatggtgc tggaaggggt ggtgaccaac      1980
     gtggccaact ttggcgcctt tgtggacatc ggtgtgcatc aggacggtct ggtgcacatc      2040
     agcgccctct ccaacaaatt cgttgaagac ccgcgcaccg tagtgaaagc cggcgacgtg      2100
     gtgaaggtga aagtgatgga ggtggacgtt ccgcgtcagc gtatcggcct ctccatgcgc      2160
     ctggatgacc aacccggtga agcccgcagc caacgcagcg gtggtcagga tcgtcccacc      2220
     cggcaacccc gtaaagagtc ccgcccggca cgccagtccg acccggccgg tggcggcctg      2280
     tccggcgcct tcgcggacgc ctttgccaac gccaaaaagc gccgttaa                   2328
//

If you have problems or comments...

PBIL Back to PBIL home page