(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE212

CP002209.PE212       Location/Qualifiers
FT   CDS_pept        complement(233079..233486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0212"
FT                   /product="heat shock protein Hsp15"
FT                   /note="COGs: COG1188 Ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog); InterPro IPR002942; KEGG: aha:AHA_0567 heat shock
FT                   protein 15; PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; SPTR: Q44264 Heat shock
FT                   protein 15 homolog; PFAM: S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74426"
FT                   /db_xref="GOA:E1SL32"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL32"
FT                   /protein_id="ADN74426.1"
FT                   /translation="MSKPSPKEIASAVRLDKWLWAARFYKTRALAQEMISGGKVQVNGQ
FT                   RCKPGRKIEVGATLTLWQGNDEKELVIVGLSEKRLSAPLAQALYEETEASITRRTERAE
FT                   QRRLMADADPRASRPDKKQRRALLRFKNQDE"
     gtgtcaaaac catcaccaaa agagattgct agcgcagttc gtctcgataa atggctctgg        60
     gctgcccgtt tttataaaac ccgggccctg gcgcaggaga tgatcagtgg cggcaaagtg       120
     caggtcaatg gccagcgctg caaaccggga cgtaagatcg aagttggtgc cacattaacc       180
     ctgtggcaag gcaacgatga gaaggaactg gtgattgtgg ggctgtcaga aaaacgtctg       240
     agcgccccgt tggcccaggc cctgtatgaa gagacagaag ccagtattac ccgccgaact       300
     gaacgggcgg agcagcgtcg cctgatggcc gacgccgatc cccgcgccag ccggccggac       360
     aagaagcagc gccgagccct gcttcgcttt aaaaatcagg atgagtaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page