(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE214

CP002209.PE214       Location/Qualifiers
FT   CDS_pept        234652..236823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0214"
FT                   /product="general secretion pathway protein D"
FT                   /note="COGs: COG1450 Type II secretory pathway component
FT                   PulD; InterPro IPR001814: IPR001775: IPR004846: IPR005644:
FT                   IPR 004845: IPR013356; KEGG: shm:Shewmr7_0151 general
FT                   secretion pathway protein D; PFAM: type II and III
FT                   secretion system protein; NolW domain protein; SPTR: A2V2N6
FT                   General secretion pathway protein D; TIGRFAM: general
FT                   secretion pathway protein D; PFAM: Bacterial type II/III
FT                   secretion system short domain; Bacterial type II and III
FT                   secretion system protein; TIGRFAM: general secretion
FT                   pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74428"
FT                   /db_xref="GOA:E1SL34"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL34"
FT                   /protein_id="ADN74428.1"
FT                   /translation="MTNLQRRLPWVRNSIAAGLLAGMAAFGGQALAAEAQYAANFKGTD
FT                   IQEFINIVGKNLNRTIIVDPTVRGKINVRSYDLLSEEQYYQFFLSVLQVYGYAVVEMPG
FT                   TNIIKVVKDKDAKDSNIRVADDAYPGEGDEMVTRIVPLYNVEAKQLAPLLRQLNNNAGG
FT                   GNVVNYDPSNVLMITGRAAVVNKLVEIVKRVDLQGDTKVEVVRLAYASAGEMVRIIDAL
FT                   YRGGGQQAATGTGSVPKVVADERTNSVVISGDERARQRAAALVRELDQEMQNSGNTKVV
FT                   YLKYAKAEDLQEVLSGFAESLQTEEGGSAQTQRRRNNEITIMAHADSNALVINAQPDQI
FT                   QTLESVIRQLDIRRAQVLVEAIIVEIAEGDEVGFGVQWGSADGGLIQYNTFGTTIGEVG
FT                   AGIWDARDVPGTEVCSPEGVCTTNPDQDGDITTLAAALSKVNGMAWGVAMGDFGALIQA
FT                   VAADSNSNVLATPSITTLDNQEASFIVGDEVPVITGSTSGSNNDNPFTTVERKEVGIKL
FT                   KVTPQINEGNAVQLEIEQEVSNVNGRTAVDVTFGKRTLTTTVLADSGETVVLGGLLNED
FT                   VQESVSKVPLLGDIPVIGHLFSSTSSKKTKRNLMIFIKPTIIRDGPSMTGIAGRKYNYF
FT                   RAQQLEQAERGINLMPNTDVPVLDEWVVPDGMSPEIHDILMRHQSGQSMSTPIRDQNEW
FT                   MQKALDGSAQPGDNATDAKEQPVEEKQND"
     atgaccaact tgcagcgtcg actgccctgg gtgcgcaaca gcattgccgc tggcctattg        60
     gccggtatgg ctgccttcgg ggggcaagcc ctggccgctg aggcacagta cgcagccaac       120
     tttaaaggca ccgacattca ggagttcatc aacattgttg gtaagaacct gaatcgcacc       180
     atcatcgtag acccgacggt gcgcgggaag atcaatgtcc gcagctatga cctgctcagt       240
     gaggagcagt actaccagtt tttcctgagc gtgctccagg tgtacggcta tgccgtggtg       300
     gagatgcccg gcaccaacat catcaaagtg gtgaaggaca aagacgccaa ggactccaac       360
     attcgcgttg ccgatgacgc ttaccccggt gaaggggatg agatggtcac ccgcatcgtc       420
     ccgctctaca acgttgaagc caagcagttg gcgccgctgc tgcgccagct caacaacaac       480
     gctggcggcg gtaacgtggt gaactacgac ccctccaacg tgctgatgat caccggccgc       540
     gctgcggtgg tgaacaagct ggtggagatc gtgaagcggg ttgacctgca gggcgacacc       600
     aaggtggagg tggttcgcct tgcctacgcc tcagcgggtg agatggtgcg catcattgat       660
     gctctgtacc gtggtggtgg tcagcaggcg gcgaccggta ccggttccgt tccgaaagtg       720
     gtggccgatg agcgcaccaa ctccgtggtg atctccggtg atgaacgtgc ccgtcagcgc       780
     gccgctgcgc tggtgcgtga gctggaccag gagatgcaga actccggtaa caccaaggtg       840
     gtgtacctca agtacgccaa agcggaagac ctgcaggaag tgctgtctgg ctttgccgag       900
     agcctgcaaa ccgaggaggg cggcagcgcc cagacccagc gtcgtcgcaa caacgaaatc       960
     accatcatgg cgcatgctga ctccaatgcg ctggtgatca atgcccagcc ggaccagatc      1020
     cagaccctgg agagcgtgat tcgtcagctc gacatccgcc gcgcccaggt gctggtggaa      1080
     gcgatcatcg tagagattgc cgaaggcgac gaagtgggct ttggtgtgca gtggggctcc      1140
     gctgatggtg gtctgatcca gtacaacacc ttcggtacca ccattggtga agtgggcgcg      1200
     ggtatctggg atgcccgtga cgtgcccggc accgaggtgt gttccccgga aggcgtgtgt      1260
     accaccaacc cggaccagga cggtgacatc accaccctgg cggcggccct gtccaaagtg      1320
     aacggcatgg cctggggtgt ggcgatgggc gactttggtg ccctgatcca ggcggtggcg      1380
     gcggactcca actccaacgt actggcgacc ccctccatca ccaccctgga taaccaggaa      1440
     gcgagcttta tcgtgggtga cgaggtgccg gtgattaccg gttccacctc cggctccaac      1500
     aacgacaacc cctttaccac cgttgagcgt aaagaggtgg ggatcaagct gaaagtgacc      1560
     ccgcagatca acgaaggcaa cgcggttcag ctcgagattg agcaggaagt gtcgaacgtt      1620
     aatggccgta ccgccgtgga cgtgaccttc ggtaagcgca ccctgaccac caccgtactg      1680
     gccgactccg gcgaaaccgt ggtgctgggc ggtctgctca acgaggacgt gcaggagagt      1740
     gtgtccaagg taccgctgct gggagacatc ccggtgattg gccacctgtt cagctccacc      1800
     agctcgaaga agaccaagcg taacctgatg atcttcatca agccgaccat catccgtgat      1860
     ggcccgagca tgaccggcat cgccggccgc aagtacaact acttccgtgc ccagcagctt      1920
     gagcaggctg agcgaggcat caacctgatg ccgaacactg atgtaccggt gctggacgaa      1980
     tgggtggtgc cggatggcat gagcccagag atccacgaca tcctgatgcg tcaccagagt      2040
     ggccagtcca tgtccacgcc gatccgcgac cagaatgagt ggatgcagaa ggcgctggat      2100
     ggcagcgccc aaccgggtga caacgcgacc gacgcgaagg aacagccggt cgaggagaaa      2160
     cagaatgact ga                                                          2172
//

If you have problems or comments...

PBIL Back to PBIL home page