(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE216

CP002209.PE216       Location/Qualifiers
FT   CDS_pept        238364..239587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0216"
FT                   /product="general secretion pathway protein F"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR003004: IPR018076: IPR001992: IPR011850;
FT                   KEGG: shn:Shewana3_0153 general secretion pathway protein
FT                   F; PFAM: Type II secretion system F domain; SPTR: A2V2N8
FT                   General secretion pathway protein F; TIGRFAM: general
FT                   secretion pathway protein F; PFAM: Bacterial type II
FT                   secretion system protein F domain; TIGRFAM: general
FT                   secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74430"
FT                   /db_xref="GOA:E1SL36"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL36"
FT                   /protein_id="ADN74430.1"
FT                   /translation="MAAFEYQALDTRGRQVKGIIEADTARQARAQLREKQMMPLEVSPA
FT                   AQKEQRSKASSGGFTLFKPKIGATALALITRQLSTLVAGGLPLEECIKAVAEQSEQPRL
FT                   KSMLMAVRAKVVEGYGLAESMAEYPQVFDELYVAMVASGEKSGHLEVVLERLADYTERR
FT                   QELNAKLTQALVYPIILTVVAISVVVFLLTSVVPDVVSQFDHLGQALPATTQFLIDISD
FT                   FLQHYGLYMLIAIALFFVGFKQALRSPKFKLSWHETLLKLPVVGKVSRGLNTARFARTL
FT                   STLSSSGVPMLEAMKIASDVLLNLKVKNAVSEATGKVREGASLRASLQQTKLFPPMMLH
FT                   MIASGEKSGELDDMLARAADNQDREFEAQVSVALAVLQPLIVVVMAGIVLFIVISILQP
FT                   MLAMNQMI"
     atggcggcgt ttgaatatca ggccctggat acccggggcc gtcaggttaa agggatcatc        60
     gaagcggaca ccgcacgcca ggcccgggcc cagctgcgtg agaagcagat gatgccgctg       120
     gaggtctccc cggcagcgca gaaagagcag cgcagcaaag cgagttctgg cggctttacc       180
     ctgttcaaac cgaaaatcgg cgccaccgcg ttggcgttga tcacccgtca gttgtccacc       240
     ctggtggcgg gcggcttgcc gttggaagag tgcattaagg cggtggctga gcagagcgaa       300
     cagcctcgcc tgaaaagcat gctgatggca gtacgcgcca aagtggtgga gggctacggc       360
     ctggccgaat ccatggccga atatccccag gtgtttgacg aactgtacgt ggccatggtg       420
     gcgtccggtg agaaatccgg tcacctcgag gtggtgctgg agcgtctggc cgattacacc       480
     gaacgccgac aggagctcaa cgccaagctg acccaggcgc tggtgtaccc gatcatcctg       540
     accgtcgtgg cgatctccgt ggtggtgttc ctgctcacct cggtggttcc ggacgtggtg       600
     tcgcaatttg accacctggg ccaggccctg ccagccacca cccagtttct gatcgacatc       660
     tcggactttc tgcagcatta cgggctctat atgctgattg ccatcgccct gttttttgtg       720
     ggctttaagc aggccctgcg cagtcccaaa ttcaagctga gctggcatga aacgctgctg       780
     aagctgccgg tggtgggtaa ggtgtcccgt ggcctgaata ccgcccgctt tgcccgcacc       840
     ctgagcacgc tctcctcttc cggggttccg atgctggaag cgatgaagat cgcctccgac       900
     gtgttgctga acctgaaggt gaagaacgcg gtctcagaag ccacaggcaa agtgcgtgag       960
     ggcgcatcgc tgcgcgcgtc gctgcagcag accaagctgt tcccgccgat gatgctgcac      1020
     atgatcgcgt ccggtgagaa gtccggtgag ctggatgaca tgctggctcg cgccgcggat      1080
     aaccaggacc gtgaatttga agcccaggtc agcgttgcgc tggccgtgct gcagccgctg      1140
     atcgtggtgg tgatggcagg catcgtgctc tttatcgtaa tttccatcct ccagcccatg      1200
     ctggcgatga accagatgat ttaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page