(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE22

CP002209.PE22        Location/Qualifiers
FT   CDS_pept        complement(27938..28882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0022"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="COGs: COG0223 Methionyl-tRNA formyltransferase;
FT                   InterPro IPR005793: IPR002376: IPR001555: IPR005794; KEGG:
FT                   aha:AHA_0257 methionyl-tRNA formyltransferase; PFAM: formyl
FT                   transferase domain protein; SPTR: A0KEW9 Methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: Formyl transferase; Formyl
FT                   transferase, C-terminal domain; TIGRFAM: methionyl-tRNA
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74236"
FT                   /db_xref="GOA:E1SUN1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:E1SUN1"
FT                   /protein_id="ADN74236.1"
FT                   /translation="MTALKIVFAGTPDFAAQHLAALLDSHHQVVAVYTQPDRPAGRGKK
FT                   LTASPVKQLALQHDLPVYQPQSLRKAEAQAELSAIDFDLMVVVAYGLILPKAVLEMPRL
FT                   GCINVHGSLLPRWRGAAPIQRAIWAGDAETGVTIMQMDEGLDTGAMLHKAALPIEDTDT
FT                   SASLYTKLAELGPKALLDALTPLADGTAVAEVQDDTLANYAEKLSKEEAAVDWSKSALA
FT                   LWRECRAFDPWPVSHFQVAEQTIKLWACDVLEQQHDAAPGTIIGADKQGIRVATGDGVL
FT                   NLTNLQLPGKKAMAVADILNARKEWFEVGTQLS"
     ttgactgcac tgaaaattgt ctttgccggt acgccggatt ttgccgctca acatctggca        60
     gccctgctgg attcccacca tcaggtggtc gcggtttaca cccagccgga ccgtccggcg       120
     ggccgtggca agaaactgac cgccagcccg gtgaaacagc tggcgctgca acacgaccta       180
     ccggtttacc agccccaatc actgcgtaag gccgaggccc aggcggagct gagcgccatc       240
     gacttcgacc tgatggtggt ggtggcgtac ggcctgatcc tgcccaaagc ggtgctggag       300
     atgccccgcc tgggttgcat caacgtgcac ggcagcttgc tgccccgctg gcgcggcgcc       360
     gcgccgattc agcgtgccat ctgggccggc gatgccgaaa ccggcgtcac catcatgcag       420
     atggatgaag gtctggacac cggcgccatg ctgcacaaag ccgcactgcc catcgaagac       480
     accgacacct ccgccagcct ctacaccaaa ctggctgagc tgggtccgaa ggcgctgctg       540
     gacgcgctga cgccgctggc cgatggcact gcggtggcgg aagtgcagga tgacaccctg       600
     gccaactacg ccgagaagct gtccaaagag gaagcggcgg tggactggag caaatccgcg       660
     ctggcgctgt ggcgcgagtg ccgtgccttc gacccctggc cggtcagcca cttccaggtg       720
     gcagagcaga ccatcaagct gtgggcctgt gacgtgctgg aacagcaaca tgatgccgct       780
     ccaggcacca ttatcggcgc ggacaaacag ggcatccggg tcgccaccgg cgacggagtt       840
     ctgaacctca ccaacctgca actgcccggc aagaaagcga tggcagtcgc ggacatcctc       900
     aacgcccgca aagagtggtt tgaggtagga acccaactgt catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page