(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE220

CP002209.PE220       Location/Qualifiers
FT   CDS_pept        241018..241761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0220"
FT                   /product="general secretion pathway protein J"
FT                   /note="COGs: COG4795 Type II secretory pathway component
FT                   PulJ; InterPro IPR012902: IPR001120: IPR010055; KEGG:
FT                   slo:Shew_3613 general secretion pathway protein J; SPTR:
FT                   A2V2P2 General secretion pathway protein J; TIGRFAM:
FT                   general secretion pathway protein J; PFAM: Prokaryotic
FT                   N-terminal methylation motif; Pseudopilin GspJ; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain;
FT                   general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74434"
FT                   /db_xref="GOA:E1SL40"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL40"
FT                   /protein_id="ADN74434.1"
FT                   /translation="MWPSRTDAVRGFTLLEMLLAIAIFAVIGVASATILQQVTKVDGVS
FT                   QGAQDDLKSLQLAMSMMERDFGQMIPRTSRSATTENRSALFEAGENLYDSDSEAMRFYR
FT                   LGWLNPQGQLPRGSIQQVVYRIKEEKLQRLYTLYPDPVEGEEAQELDLLDGVISLKFAF
FT                   YIDDKWQNKVDGNAFPKAVTVELETLDMGIIQRKFLLADGYGGITSDEDDNGSGNGSGS
FT                   GSGNGSGSGSGSGSSGGGTGGEEQN"
     atgtggccaa gccggactga cgcggtgcgg ggttttaccc tgctggagat gctgctggcc        60
     atcgccatct tcgcggtgat cggcgtcgcg tccgctacca tcctgcagca ggtcaccaag       120
     gtcgatggcg tcagccaggg ggcccaggat gatctcaaat cccttcagct ggcgatgtcg       180
     atgatggagc gcgacttcgg ccagatgatc ccccgtacct cccgcagtgc caccacggag       240
     aaccgcagtg ccctgttcga ggctggggag aacctgtacg actccgacag cgaagcgatg       300
     cgcttctatc gactcggctg gctcaacccc cagggccagt tgccccgggg ctcgattcag       360
     caggtggtgt accgaatcaa ggaggagaag ctgcaacggc tctacaccct gtatccggat       420
     ccggtagagg gcgaagaagc tcaggagctg gatctgctgg atggcgtgat cagcctgaag       480
     tttgccttct acatcgacga caagtggcag aacaaggtcg atggcaatgc cttccccaag       540
     gcggtgactg tggagctgga gaccctcgac atgggcatca ttcagcgcaa attcctgttg       600
     gcggacggtt acggtggcat caccagcgat gaggacgaca acggcagcgg caacggctcg       660
     gggtcgggct ctggcaatgg ttctggcagt ggctccggct ccggcagcag tggtggtggc       720
     accggcggcg aggagcagaa ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page