(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE221

CP002209.PE221       Location/Qualifiers
FT   CDS_pept        241761..242756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0221"
FT                   /product="General secretion pathway protein K"
FT                   /note="COGs: COG3156 Type II secretory pathway component
FT                   PulK; InterPro IPR005628; KEGG: sfr:Sfri_0112 general
FT                   secretion pathway protein K; PFAM: General secretion
FT                   pathway protein K; SPTR: A2V2P3 General secretion pathway
FT                   protein K; PFAM: General secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74435"
FT                   /db_xref="GOA:E1SL41"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:E1SL41"
FT                   /protein_id="ADN74435.1"
FT                   /translation="MRRSQSGMALLTVLLVLAVITALAAGMTQRSQMSVRRTTNMADFE
FT                   QAYWYARSSEALAKRVLKQDFEDSDGTIHLQQYWATANVVYPVEHGQIAGTIDDMRTCF
FT                   NLNALSQGLTEEERNRDPYQKPLAGRQFMAMLEALEIDNYYAEMVADRVRDFTDEDDRQ
FT                   DGTFGAEDAEYESRPVPYRTPNQLMAHHSELRAVLGVNKNLYRTLQDYVCAIPGEDTQQ
FT                   LNVNTLPVERAALLVGMLEGKISLSEAESVLQARPADGWDDVQKFWEEPAMQRLQVDAQ
FT                   AKSTLAVDSKYFRLRGAAKVENAVFRLESVMRRGGGDGLTVLTRQYGGQQ"
     atgcgacgtt cccagtcggg catggccctg ttgacggttt tgttggtgct ggcggtgatc        60
     acggcgctgg cggcgggcat gacccagcgc agccagatgt cggtgcgccg caccaccaat       120
     atggcggatt tcgagcaggc gtactggtac gcccgctcca gtgaggctct ggccaagcgg       180
     gtgctgaagc aggactttga ggacagcgac ggcaccatcc acctgcaaca atattgggcc       240
     accgccaacg tggtgtaccc ggtagagcat ggccagatcg ccggcaccat tgatgatatg       300
     cggacctgtt tcaacctcaa cgccctcagc caggggctga ccgaagagga acgaaaccgg       360
     gatccctacc aaaaaccctt ggctggccga cagtttatgg ccatgctgga ggcattggag       420
     atcgacaact actacgccga gatggtggcc gaccgggtgc gggactttac cgacgaagat       480
     gaccgtcagg atggcacctt tggtgcggag gacgccgagt acgagtcacg gccggtgccc       540
     taccgcaccc ccaaccagct gatggctcac cacagcgagt tgcgggcggt gcttggggtg       600
     aacaagaacc tgtaccggac gctgcaggat tacgtctgcg ccattcccgg tgaagacacc       660
     cagcaactca acgtcaacac cctgccggtg gaacgggcag cgctgttggt cgggatgctg       720
     gaaggaaaga tcagcctcag tgaggcggag agcgttctgc aagcccgacc ggcagacggt       780
     tgggacgacg ttcagaaatt ctgggaagaa cccgccatgc aacgattgca ggtggacgcc       840
     caggccaagt ccaccctggc ggtggacagc aagtatttcc ggctccgcgg agccgctaaa       900
     gtggaaaacg cggtgtttcg attggaaagc gtgatgcgac gtggcggggg cgatggactg       960
     accgttctga cccgccagta tggaggccaa cagtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page