(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE225

CP002209.PE225       Location/Qualifiers
FT   CDS_pept        245205..245759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0225"
FT                   /product="NUDIX hydrolase"
FT                   /note="InterPro IPR020476: IPR000086: IPR020084; KEGG:
FT                   swd:Swoo_4718 ADP-ribose diphosphatase NudE; PFAM: NUDIX
FT                   hydrolase; SPTR: A2V2Q2 NUDIX hydrolase; PFAM: NUDIX
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74439"
FT                   /db_xref="GOA:E1SLP0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP0"
FT                   /protein_id="ADN74439.1"
FT                   /translation="MSKSRKPQILDARVVAQSRLFTVEQLDLRFANGAQRQYERMRGGN
FT                   RGAVMVVPMLDEHTMLLVREYAAGTHSYELGFPKGLIDPGEAMLVAANRELQEEIGYAA
FT                   RDLTHLMQVSLAPGYFASKMEILLARDLYPSQLIGDEPEPLELVPWSIHEADKLLAQED
FT                   FSESRSISALFLALKQLKLTR"
     atgagcaaat cgcgtaagcc gcagatcctg gatgcccgag tggtggcaca aagccggctg        60
     ttcacggtgg agcagctgga tctgcgtttt gccaatggcg ctcagcgtca gtatgagcgc       120
     atgcgcggcg gcaatcgtgg ggcggtaatg gtggtgccga tgctggatga gcacaccatg       180
     ttgctggtgc gtgagtacgc cgcaggcacc cacagctacg agctgggctt tcccaagggg       240
     ttgatcgatc cgggtgaagc gatgctggtg gcggccaacc gggagctgca ggaggagatc       300
     ggttacgccg cccgtgattt gacccacctg atgcaggtgt cgttggcacc aggttacttt       360
     gccagcaaga tggaaattct gctggcccgt gacctctatc ccagtcaact gattggtgac       420
     gagccggaac cgctggaact ggtgccgtgg tcgatacacg aagccgataa gctgctggcg       480
     caggaagatt tttctgaatc ccgctcgatc agtgccttgt ttttggctct gaagcagctg       540
     aaacttaccc gataa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page