(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE226

CP002209.PE226       Location/Qualifiers
FT   CDS_pept        245788..246621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0226"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="COGs: COG1218 3'-Phosphoadenosine 5'-phosphosulfate
FT                   (PAPS) 3'-phosphatase; InterPro IPR000760: IPR006240; KEGG:
FT                   ppr:PBPRA3469 putative CysQ protein; PFAM: inositol
FT                   monophosphatase; SPTR: A3EJE2 CysQ protein; TIGRFAM:
FT                   3'(2'),5'-bisphosphate nucleotidase; PFAM: Inositol
FT                   monophosphatase family; TIGRFAM: 3'(2'),5'-bisphosphate
FT                   nucleotidase, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74440"
FT                   /db_xref="GOA:E1SLP1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP1"
FT                   /protein_id="ADN74440.1"
FT                   /translation="MVTPLHTLLEPVITIARDAGQQIRTIYEAGQYQSLTKSDNTPVTS
FT                   ADLAAHEWIVTALRTLTPDTPILSEEDADIPLSTRQHWNEYWLIDPLDGTQEFIAGSGE
FT                   FAVNIALVRDHQPVLGVIYAPMSEVWYYACQGHGAYKRHGDQTEAIHSRDVGPGDALKI
FT                   AVSRRQRREAVMSRLDEQREYLLLPFGSASLKSCMVAEGTADCYLRLGPTGEWDTGASQ
FT                   CIVEEAGGRIVDTCYQPLSYNERESLENPNYMVLGCQSLPWQEILPPGPECYSAE"
     gtggtgactc ccctgcacac actgctagaa cccgtcatca ccattgcccg tgatgcggga        60
     caacagatcc gcaccatcta cgaggcgggt caatatcagt ccctgaccaa atccgacaac       120
     acccccgtga cctcggccga cctggccgcc catgagtgga tcgtcacggc gctgcgaacg       180
     cttaccccgg acacacccat cctctccgag gaggacgccg atatcccgct gtccacccgc       240
     cagcactgga atgagtactg gctgattgac ccgctggacg gcacccagga gtttattgcc       300
     ggcagtggcg agtttgcggt gaacattgcg ctggtgaggg atcatcagcc tgtgctgggg       360
     gtgatctacg cgccgatgag tgaagtctgg tactacgcct gtcagggcca cggcgcctac       420
     aagcgccacg gtgaccagac tgaagcgatc cacagtcgtg atgtggggcc gggggacgca       480
     ctgaagattg cggtcagccg ccgtcagcgt cgcgaagcgg tgatgtcacg gctggatgaa       540
     cagcgggaat acctgctgct gccatttggc agtgcgtcac tgaaatcctg catggtggcg       600
     gaaggcaccg cggattgcta tctgcgcctt gggccgaccg gcgagtggga caccggagcc       660
     tcccagtgca tcgttgagga agcgggcggc aggatcgtcg acacctgcta ccaaccgttg       720
     agctacaacg agcgcgagag cctggaaaac cccaactaca tggtgttggg ctgtcagagc       780
     ctgccctggc aagagattct gcctccgggc ccggagtgtt attcagcgga atag             834
//

If you have problems or comments...

PBIL Back to PBIL home page