(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE227

CP002209.PE227       Location/Qualifiers
FT   CDS_pept        complement(246656..247756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0227"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="COGs: COG2603 ATPase; InterPro IPR001763: IPR017582;
FT                   KEGG: sfr:Sfri_0119 tRNA 2-selenouridine synthase; SMART:
FT                   Rhodanese domain protein; SPTR: Q089T3 tRNA 2-selenouridine
FT                   synthase; TIGRFAM: tRNA 2-selenouridine synthase; PFAM:
FT                   Rhodanese-like domain; TIGRFAM: tRNA 2-selenouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74441"
FT                   /db_xref="GOA:E1SLP2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP2"
FT                   /protein_id="ADN74441.1"
FT                   /translation="MSEMIPQSEYRRLLLDDVPMIDLRAPVEFAKGAFPGSVNCPLMTD
FT                   SEREAVGTRYKEQGQNAAIALGHQLVNGAVKQSRVDAWVSQVTARPDTVLYCFRGGLRS
FT                   QLSQGWLAEAGYQRPYIEGGYKGMRGFLINQTDKVAEQADLLILGGMTGCGKTDFLNER
FT                   RDSVDLEGLANHRGSSFGRRIGGQPSQIDFENRLAIELMRHQDAGHRQLLLEDESRLIG
FT                   RESIPLTLFDAMTQAPRVMLEVSNEARIAQITKDYVTTMANDYLAQDAEQGFAEFENYL
FT                   LGSLDRIRRRLGGALHQDLRQRMTDALAEQARSGNVDGHSGWISLMLSHYYDPMYRYQL
FT                   EKMTAPVLFQGSPEAVHQFLNERGAR"
     atgagcgaga tgatcccgca gagcgaatac cgtcgcctgc tgctggacga tgtgccgatg        60
     atcgatctgc gcgccccggt ggagttcgcc aagggcgcct tccccggctc ggtcaactgc       120
     ccgctgatga ccgacagtga gcgggaagcg gtgggcaccc gctacaagga gcagggtcaa       180
     aacgcggcca ttgcactggg ccaccaactg gtgaatggcg ccgtgaaaca gagccgcgtg       240
     gacgcctggg tcagccaggt aaccgcccgc ccggataccg tactctactg ttttcgtggc       300
     ggcctgcgct cccagttgag ccagggctgg ctggcggaag ccggctacca acgtccctac       360
     atcgagggcg gctacaaagg gatgcgcggc ttcctgatca accaaaccga taaggtggct       420
     gaacaggcag acctgctgat cctgggcggc atgaccggct gcggcaaaac cgactttctg       480
     aacgagcgac gggacagcgt ggacctggaa gggctcgcca accatcgagg ttccagcttt       540
     gggcgtcgca tcggtgggca acccagccag atcgatttcg agaaccggct tgccattgaa       600
     ctgatgcgtc atcaggacgc gggccaccgg cagttgctgc tggaggacga aagtcgcctg       660
     attggacggg aatcgattcc gctcaccctg ttcgacgcga tgactcaggc cccccgggtg       720
     atgctggagg tgagtaacga ggcacgcatt gcccagatca ccaaagacta cgtcaccacc       780
     atggccaacg attatctggc ccaggacgcc gagcagggct ttgccgagtt tgagaactac       840
     ctgctgggca gcctggaccg catccgtcgt cgtttgggcg gtgccctgca tcaggacctg       900
     cgtcagcgca tgacagacgc cctggcggaa caggcacgca gtggcaacgt tgatggccac       960
     agcgggtgga tcagcctgat gctgagccac tactacgacc cgatgtaccg ctaccagctg      1020
     gagaagatga ccgctccggt gctgttccag ggcagccccg aagccgtgca ccagttcctc      1080
     aatgaacgcg gtgcccgcta a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page