(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE23

CP002209.PE23        Location/Qualifiers
FT   CDS_pept        complement(28892..29407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0023"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="COGs: COG0242 N-formylmethionyl-tRNA deformylase;
FT                   InterPro IPR000181; KEGG: sdn:Sden_0024 peptide
FT                   deformylase; PFAM: formylmethionine deformylase; PRIAM:
FT                   Peptide deformylase; SPTR: Q8EKQ8 Peptide deformylase 1;
FT                   TIGRFAM: peptide deformylase; PFAM: Polypeptide
FT                   deformylase; TIGRFAM: peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74237"
FT                   /db_xref="GOA:E1SV83"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV83"
FT                   /protein_id="ADN74237.1"
FT                   /translation="MAVREVLRFPDERLRTVAEPVTDFGPALQQLVDDMFDTMYEERGI
FT                   GLAATQINEHVQVIVMDHSEDRSEPKVFINPKIIEEKGHFTNEEGCLSVPGVYAKVERA
FT                   EHVVFEAQDREGNPFTVEADELLSICIQHEMDHLLGKLFVDYLSPLKRQRIKQKLEKQA
FT                   RLDAKHAS"
     atggccgtta gagaagttct gcgttttccc gatgaacgcc tgcgcaccgt cgcagaaccg        60
     gtgaccgatt tcggcccggc ccttcagcag ctggtggacg atatgttcga caccatgtac       120
     gaagagcgcg gtatcggcct ggccgctacc caaatcaatg agcacgttca ggtgatcgtg       180
     atggaccact ccgaggaccg cagcgagccc aaagtgttca tcaaccccaa aatcatcgaa       240
     gagaaaggcc acttcaccaa tgaagagggc tgtctctccg tgccgggcgt gtacgccaaa       300
     gttgagcgcg ccgagcacgt cgtgtttgaa gctcaggacc gtgaaggcaa cccctttacc       360
     gtggaagcgg acgagctgct ctccatctgc atccagcacg agatggatca cctgttgggc       420
     aagctgtttg tggactacct ctctcccctg aagcgccagc gcattaagca aaagctggag       480
     aaacaggccc gccttgacgc caaacacgct tcctag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page