(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE230

CP002209.PE230       Location/Qualifiers
FT   CDS_pept        250441..253038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0230"
FT                   /product="peptidase S45 penicillin amidase"
FT                   /note="COGs: COG2366 Protein related to penicillin acylase;
FT                   InterPro IPR002692; KEGG: shm:Shewmr7_3263 peptidase S45,
FT                   penicillin amidase; PFAM: peptidase S45 penicillin amidase;
FT                   SPTR: A2UWX6 Peptidase S45, penicillin amidase; PFAM:
FT                   Penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74444"
FT                   /db_xref="GOA:E1SLP5"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLP5"
FT                   /protein_id="ADN74444.1"
FT                   /translation="MTRKYPLILAGILTSLTLSGCSDDKDDVAVTPPPPPVVPEPEPEP
FT                   KPELVVFAPEGALEARIRRTEFGVPHITADNLESLAFGSGYAQATDHLCLLADGFIKAN
FT                   SERSKYFGPHKRIDYATGLPLVEDNQNLINDFGHLALGVRASAEAKFDALPDRSRAMLN
FT                   GFAQGYNLYLTDLASGAIETPNLPCAGQPWVKPVEGVDLLTYLFSIAHLPGSANFFDLI
FT                   FFANPGDGNEYLPVPVTPMTAATTAQYQDLTARAQRQAAQLTTPVLNERDLGSNGWGLG
FT                   ADVTENGKGIVLGNPHFPHTGQLRFWQSHLTIPDQMDVMGGSLVGMPGAINIGFNEHLA
FT                   WTHTFSTAEHFVLYQLALAEGDRMTYLLDGEPMPITATPHQIEVNVGGGQTMVLEKTLY
FT                   TTAKGPMVEAPPQAAPFTWNDNVAFFVQDANTANVDVLEHWLSMNLATDLESFQQAFRD
FT                   YDGVIFNNTMYADAEGNAFYIDDSTVPHLSETAKVALTSDRVLITLKEQAGFTILPGYD
FT                   STYGFDGAVPYEEAPKLLRSDFVQNSNNSFWSTNPAAPIEGISPLYGPERGEQSLRTRM
FT                   ALTLMSDARGDDDKFNRDEVEAALLNNRAYLAELVLDDLLSQCEAQGTTPVVVNESLSV
FT                   NVAPACAALAQWNGAQNLDSVAGALLREFGYQFNSGLLSVPFDYTDPMNTPNTLVTDGR
FT                   ALVALAVASENLTRNGFALDATLGSLQFVEKSLPDGSASGARFPWSGANNFEGGFNVFS
FT                   YSASGGDDTLLPQHAYAPAIDVVTGAPMRSRLSTEGYHVRYGSSWMMVVGFEDDGPVAR
FT                   GLLSYSESNNPLSPHWNDQTRYYSENTALRPLRFTEDAIAEALLSDQTIRHQQ"
     atgacaagaa aatacccgct gatcctcgcc gggatcctga cctctctgac gctgtcaggc        60
     tgtagcgacg acaaagacga tgtggcggtg acgccgccac ctccgccggt ggtacctgag       120
     ccggaacccg agcccaagcc ggagctggtg gtgtttgccc cggaaggcgc actggaagca       180
     cggattcgtc gcaccgaatt cggcgtaccg cacatcaccg ctgacaatct ggagagcctg       240
     gcattcggtt ccggttacgc ccaggccacc gaccacctct gcttgctggc ggatggtttt       300
     atcaaggcca acagtgaacg ctccaagtac tttggccccc acaagcgaat cgattacgcc       360
     accggcctgc cgctggtgga ggacaatcag aacctgatca acgacttcgg ccatctggcg       420
     ctgggcgtgc gcgcctccgc ggaagcgaag tttgatgccc tgccggatcg cagccgggca       480
     atgcttaacg gttttgccca gggttataac ctctatctga ccgatttggc ctccggcgcg       540
     atcgaaaccc cgaacctgcc ctgtgccggt cagccctggg tgaagccggt ggagggggtc       600
     gatctgctga cctacctgtt ctcgattgcg cacctgccgg gcagtgcgaa cttctttgac       660
     ctgatcttct ttgccaaccc cggtgatggc aatgagtacc tgccggtgcc cgtgacgccg       720
     atgaccgccg cgaccaccgc gcagtatcag gacctcaccg cccgtgccca gcgtcaggcg       780
     gcgcagttga ccactccggt gctcaatgag cgggatctgg gctccaacgg ttggggcctg       840
     ggggccgacg tgacggagaa cggcaaaggc atcgtgctgg gcaatccgca cttcccccac       900
     actgggcagc ttcgcttctg gcagtcccac ctgaccattc cggaccagat ggatgtgatg       960
     ggcgggtcgc tggtgggtat gcccggggcc atcaacatcg gctttaacga acacctggcc      1020
     tggacccaca ccttctctac cgcggagcat ttcgtgctgt accaactggc gctggcggaa      1080
     ggtgaccgca tgacctatct gctggatggc gagccgatgc ccatcaccgc caccccgcac      1140
     cagattgagg tgaacgtggg cggcggccag accatggtgc tggagaaaac cctgtacacc      1200
     accgccaagg ggccgatggt ggaagcgcca ccccaggcgg cgccctttac ctggaacgac      1260
     aatgtggcgt tctttgttca ggacgccaat accgccaatg tggacgtgct ggagcactgg      1320
     ttgtcgatga acctcgccac cgatctggag agcttccagc aggcgttccg tgattacgat      1380
     ggggtgatct tcaacaacac catgtacgcc gatgctgagg gcaacgcctt ctatatcgac      1440
     gactccaccg tgccgcacct gagcgaaacc gcgaaagtgg cgctgacctc tgaccgggtg      1500
     ttgatcaccc tcaaggagca ggcgggcttt accatcctgc cgggttacga cagcacctac      1560
     ggctttgatg gggcggtgcc ctacgaagag gcccccaagc tgctgcgctc cgactttgtt      1620
     cagaactcca ataactcctt ctggtccacc aacccggcgg cccccattga ggggatctcg      1680
     ccgctgtatg gacctgagcg gggtgagcag tcactgcgca cccggatggc gttgacgctg      1740
     atgagtgacg cccgtggtga cgacgacaag ttcaaccgcg atgaggtcga agcggcgctg      1800
     ctgaacaacc gggcctacct ggccgagctg gtgctggatg acctgctgag ccagtgtgaa      1860
     gcccagggca ccacaccggt ggtggtgaat gagagcctga gcgtgaacgt cgcccccgcc      1920
     tgtgcggctc tggcccaatg gaatggggca cagaacctgg acagtgtggc cggggcgctg      1980
     ttgcgcgagt tcggttacca gttcaactcc gggctgttgt cggtcccctt cgactacacc      2040
     gatccgatga acacccccaa caccctggtg accgacggcc gggcgctggt ggcgctggcc      2100
     gttgccagtg aaaacctgac ccgtaacggc tttgcgctgg acgccaccct gggcagcctg      2160
     cagtttgttg agaagtctct gccggatggc agcgcctccg gagcacgctt cccctggtct      2220
     ggcgccaata actttgaggg gggctttaac gtcttctctt acagcgccag cggcggcgat      2280
     gacaccctgc tgccccagca cgcctatgcg ccggccattg atgtggtcac cggtgcgccg      2340
     atgcgctccc gtttgtccac cgagggttac cacgtgcgtt acggctccag ctggatgatg      2400
     gtggtgggct ttgaggatga cggcccggtg gcgcgcggtc tgctgagtta ctcggaatcc      2460
     aataacccgc tgtcgcccca ctggaatgac caaacccggt actactcgga aaacactgcg      2520
     ctgcgtccgt tgcgctttac tgaggacgcc attgcggaag cgttgctgtc ggaccagacc      2580
     atccgtcacc agcagtaa                                                    2598
//

If you have problems or comments...

PBIL Back to PBIL home page