(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE242

CP002209.PE242       Location/Qualifiers
FT   CDS_pept        271244..272206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0242"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="COGs: COG0340 Biotin-(acetyl-CoA carboxylase)
FT                   ligase; InterPro IPR003142: IPR013196: IPR004143:
FT                   IPR004408; KEGG: aha:AHA_4040 BirA bifunctional protein;
FT                   PFAM: biotin/lipoate A/B protein ligase; Helix-turn-helix
FT                   type 11 domain protein; biotin protein ligase domain
FT                   protein; PRIAM: Biotin--[acetyl-CoA-carboxylase] ligase;
FT                   SPTR: P37416 Bifunctional protein birA; TIGRFAM:
FT                   biotin/acetyl-CoA-carboxylase ligase; PFAM: HTH domain;
FT                   Biotin protein ligase C terminal domain; Biotin/lipoate A/B
FT                   protein ligase family; TIGRFAM: birA,
FT                   biotin-[acetyl-CoA-carboxylase] ligase region; BirA biotin
FT                   operon repressor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74456"
FT                   /db_xref="GOA:E1SLQ7"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLQ7"
FT                   /protein_id="ADN74456.1"
FT                   /translation="MLSTIRQQLIAALADGQFHSGAHLAEQLGVSRAAIHNHIEALSTL
FT                   GLDLYRVKGKGYRLAQPLSLLSADHIGVAERPAPLHLLWQVDSTNAFLLARAKQCRNGE
FT                   ACLAEMQTGGRGRRGRTWVSPIASHLYLSYFWRLEQGLAAAGGLSLAVGVMLCEALESL
FT                   GVSGLTLKWPNDIYLNGRKLAGILVEVSGQQGEACELVIGCGVNVTMPESMAALIDQPW
FT                   ADLAGEGIAPSRSELARRVLEHLDAGMRDFELEGLTPFVARWLARDQFADTPVKLLLGN
FT                   QEVIGVARGIDPQGHLLLALPDGTVKRFAGGELSLRPRD"
     atgttgtcga cgattcgtca gcagttgatc gcggcgttgg ccgatggtca gtttcattcc        60
     ggcgcccacc ttgccgagca actcggtgtg tcacgggcgg cgatccataa ccacattgaa       120
     gcgttatcaa cccttgggct ggatctttac cgggttaagg gcaaaggcta ccgcctggct       180
     cagcctctga gtctgctcag cgctgaccat atcggtgtgg ctgagcgtcc cgcccctctg       240
     cacctgctgt ggcaggtgga ctccaccaac gcctttttgc tggcccgtgc caagcagtgc       300
     cgcaatggtg aggcgtgcct ggctgagatg cagaccggtg gccgtggccg acgtggccgt       360
     acctgggtgt cgccaatcgc ctcccacctc tatctctctt acttctggcg tctggagcag       420
     ggtttggctg cggccggcgg actgagtctg gcggttgggg tgatgctgtg tgaggcgctg       480
     gagtcgctgg gggtatccgg cctgacactg aaatggccca acgacatcta tctcaatggg       540
     cgcaagctgg ccgggattct ggttgaggta tcgggtcagc agggggaagc ctgcgaactg       600
     gtgattggct gtggcgtcaa tgtgacgatg ccagagtcga tggccgcgtt gatagaccag       660
     ccgtgggccg atttggccgg ggagggcatt gcgccgtccc gcagcgagtt ggcgcgccgg       720
     gtgttggaac acctcgatgc cggtatgcgg gattttgagc tggaggggct gacgccgttc       780
     gttgcccgct ggctggcgcg ggatcagttt gccgatacac cggtaaagct gctgctgggc       840
     aaccaggagg tgatcggcgt ggcacggggt atcgaccctc agggccatct gttgctggcc       900
     ctgccggatg ggacggtaaa gcggtttgcc ggtggtgaac tgagtctgcg cccgagggat       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page