(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE247

CP002209.PE247       Location/Qualifiers
FT   CDS_pept        276275..276703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0247"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="COGs: COG0080 Ribosomal protein L11; InterPro
FT                   IPR000911: IPR006519; KEGG: vpa:VP2926 50S ribosomal
FT                   protein L11; PFAM: ribosomal protein L11; SMART: ribosomal
FT                   protein L11; SPTR: Q87KQ0 50S ribosomal protein L11;
FT                   TIGRFAM: ribosomal protein L11; PFAM: Ribosomal protein
FT                   L11, RNA binding domain; Ribosomal protein L11, N-terminal
FT                   domain; TIGRFAM: 50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74461"
FT                   /db_xref="GOA:E1SLR2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR2"
FT                   /protein_id="ADN74461.1"
FT                   /translation="MAKKVQAYIKLQVAAGAANPSPPVGPALGQHGVNIMEFCKAFNAR
FT                   TEKLEKGLPIPVVITVYADRSFTFVTKTPPASVLLKKAAGLKSGSSRPNTEKVGTITMA
FT                   QVKEIAETKAADMTGADIDAMARSIAGTARSMGLVVED"
     atggctaaga aagtccaagc ctacatcaag ctgcaggttg cagctggtgc cgctaacccg        60
     tctccgccgg taggtccggc tctgggtcag cacggcgtaa acatcatgga attctgtaag       120
     gcgtttaacg ctcgtacaga aaaactggaa aaaggtctgc cgatcccggt tgtgatcacc       180
     gtttacgctg accgttcctt cacctttgtt accaagaccc cgccggcttc cgttctgctg       240
     aagaaagccg ctggtctgaa gtctggttcc agccgtccta acactgagaa agtgggtacc       300
     atcaccatgg ctcaggttaa agaaatcgct gaaaccaagg ctgctgacat gactggtgcg       360
     gacatcgatg caatggctcg ctccatcgct ggtactgccc gttccatggg cctggtagtg       420
     gaggattaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page