(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE250

CP002209.PE250       Location/Qualifiers
FT   CDS_pept        278202..278570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0250"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="COGs: COG0222 Ribosomal protein L7/L12; InterPro
FT                   IPR013823: IPR000206; KEGG: saz:Sama_0205 50S ribosomal
FT                   protein L7/L12; PFAM: Ribosomal protein L7/L12; SPTR:
FT                   A1S210 50S ribosomal protein L7/L12; TIGRFAM: ribosomal
FT                   protein L7/L12; PFAM: Ribosomal protein L7/L12 C-terminal
FT                   domain; TIGRFAM: ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74464"
FT                   /db_xref="GOA:E1SLR5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR5"
FT                   /protein_id="ADN74464.1"
FT                   /translation="MSITKDQIIEAVAAMSVMEVVELIEAMEEKFGVSAAAAVVAGGAG
FT                   DAAAAEEKTEFDVILAEAGSNKVGAIKAVRGATGLGLKEAKALVESAPAAIKEGISKEE
FT                   AEALKKDLEEAGCKVELK"
     atgtctatca ccaaagacca aatcatcgaa gccgttgcag ccatgtctgt aatggaagtt        60
     gttgaactga tcgaagctat ggaagagaag ttcggtgttt ctgctgctgc tgctgttgta       120
     gctggtggcg ccggcgacgc agccgctgct gaagagaaga ccgagttcga cgtaatcctg       180
     gccgaagctg gttccaacaa agttggcgct attaaagcag ttcgcggcgc aactggcctg       240
     ggtctgaaag aagctaaagc tctggtagaa tctgctccgg cagctatcaa agaaggcatc       300
     tctaaagaag aagccgaagc tctgaagaaa gacctggaag aagccggctg taaagttgag       360
     ctcaagtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page