(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE252

CP002209.PE252       Location/Qualifiers
FT   CDS_pept        282908..287116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0252"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit; InterPro IPR007081: IPR007066:
FT                   IPR000722: IPR007083: IPR 007080: IPR006592: IPR012754;
FT                   KEGG: saz:Sama_0207 DNA-directed RNA polymerase subunit
FT                   beta'; PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein; SPTR: A1S212
FT                   DNA-directed RNA polymerase subunit beta'; TIGRFAM:
FT                   DNA-directed RNA polymerase, beta' subunit; PFAM: RNA
FT                   polymerase Rpb1, domain 2; RNA polymerase Rpb1, domain 4;
FT                   RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1, domain
FT                   5; RNA polymerase Rpb1, domain 3; TIGRFAM: DNA-directed RNA
FT                   polymerase, beta' subunit, predominant form"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74466"
FT                   /db_xref="GOA:E1SLR7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR7"
FT                   /protein_id="ADN74466.1"
FT                   /translation="MKDLLQFLKKQNASEEFNGIKIGLASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVIEPGMTALERGQMLTEE
FT                   EYLDALEEHGDEFDARMGAEAVQQLLKDIDLESEIAVMREELPQTNSETKRKKLTKRLK
FT                   LMEAFYNSGNKPEWMIMGVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNRRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYGKLEARGLATTIKAAKK
FT                   MVEREVAEVWDVLDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPASGDPIIVPSQDVVLGLYYMTREK
FT                   VNGKGEGMVLSSVEEAEKVYRAGLVDLHARVKVRITDSYKTEEGEIVEERKIIDTTIGR
FT                   AILSMILPKGLPFALINQDMGKKPISAVLNSCYRILGLKSTVIFADQLMYTGFHFATVS
FT                   GTSVGINDMVIPDAKKEIVASAEEEVAEISEQFQAGLVTAGERYNKVIDIWASANEKVS
FT                   KAMMENLKTDTVINRDGAEEEQKSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPIVANFREGLNVQQYFISTHGARKGLADTALKTANSGYLTRRLVDVSQDLVIVEQ
FT                   DCGSVEGISVKPLIEGGDVVEPLRERVLGRVVAQDVIKPGTEDEVLIPRNTLLDEKWCD
FT                   LIEAHSVDEILVRSVITCQTDFGVCAHCYGRDLARGHLVAEGEAIGVVAAQSIGEPGTQ
FT                   LTMRTFHIGGAASRASAESNVQVKNSGILKLQNAKYVTNADGKIVVTSRSTELAVIDDL
FT                   GREKERYKLPYGAVLDKSEGAAVAAGDIVANWDPHTHPIITEVEGRIQFVDMVEGVTMT
FT                   KQTDELTGLSSIVILDVAQRTSAGKEMRPMVKLIDESGNDILIPGTEVPAQYFLGGHAI
FT                   VSIDDGTMVRVGDALARIPQESGGTKDITGGLPRVADLFEARKPKEPAILAEITGTISF
FT                   GKETKGKRRLVITPHDGGQPYEEMIPKWRNLNVFEGEKVERGEVIADGPEAPHDILRLR
FT                   GIHAVANYIVNEVQDVYRLQGVKINDKHIEVVIRQMLRKCIILNGGDSEFLAGEQVEVA
FT                   RVHQANRLLEEQGKQPATYERELLGITKASLATESFISAASFQETTRVLTDAATYGKRD
FT                   DLRGLKENVTVGRLIPAGTGYAYHRSRQQQAQEAAPAVTASEAEQNLADLLNAAGPNDQ
FT                   "
     gtgaaagact tacttcagtt tcttaagaaa cagaatgcgt ccgaagaatt taacggcatc        60
     aagatcggcc tcgcgtcgcc ggacatgatc cgtagctggt ctttcggtga agtaaagaag       120
     ccggaaacca tcaactaccg taccttcaag ccggagcgtg acggtctgtt ctgtgcccgt       180
     atctttggtc cggtaaagga ctatgagtgt ctgtgtggca agtacaagcg tctgaagcac       240
     cgcggtgtga tttgtgagaa gtgtggcgtt gaagtgaccc aaaccaaagt gcgtcgtgag       300
     cgcatgggtc acatcgagct ggcttctccg gtggcgcaca tctggttcct gaagtccctg       360
     ccgtcccgta ttggtctgtt gctggacatg accctgcgtg acatcgagcg ggtgctgtac       420
     ttcgaaagct acgtggttat cgagccgggc atgaccgccc tggagcgtgg ccagatgctg       480
     accgaagagg agtatctgga tgccctggaa gagcatggtg acgagttcga cgcccgtatg       540
     ggtgccgagg ccgttcagca gctgctcaag gacatcgatc tggaaagcga aatcgccgtt       600
     atgcgcgaag agctgcccca gaccaactcc gaaaccaagc gtaagaagct gaccaagcgt       660
     ctgaagctga tggaagcctt ctacaactct ggcaacaagc cggagtggat gatcatgggc       720
     gttctgccgg ttctgccgcc ggatctgcgt ccgctggtac cgctcgacgg tggccgcttc       780
     gcgacctccg atctgaacga tctgtaccgc cgcgtgatca accgtaacaa ccgtctgaag       840
     cgtctgctgg acctggctgc cccggacatc atcgtgcgca atgaaaagcg catgctgcaa       900
     gagtccgtgg acgccctgct ggacaacggc cgtcgtggtc gtgccatcac cggttccaac       960
     cgccgtccgc tgaagtctct ggctgacatg atcaagggta agcaaggtcg cttccgtcag      1020
     aacctgctgg gtaagcgcgt ggactactcc ggtcgttccg taattaccgt gggtccgacc      1080
     ctgcgcctgc accagtgtgg tctgccgaag aagatggctc tggagctgtt caagcccttc      1140
     atctacggca agctggaagc ccgtggcctg gccaccacca tcaaagccgc caagaaaatg      1200
     gtggagcgtg aagtggctga ggtatgggac gttctggatg aagttatccg cgaacacccg      1260
     gtactgctga accgtgcacc gacccttcac cgtctgggta tccaggcgtt cgaaccggtg      1320
     ctgatcgaag gtaaagcgat tcagctgcac ccgctggtgt gtgcggccta caacgctgac      1380
     ttcgatggtg accagatggc ggtacacgta ccgctgaccc tggaagccca gctggaagcc      1440
     cgcgccctga tgatgtccac caacaacatc ctgtcgcccg cttctggtga tccgatcatc      1500
     gtaccgtctc aggacgtggt actgggtctg tactacatga cccgtgaaaa ggtgaacggc      1560
     aaaggcgaag gcatggtgct ctcctccgta gaagaagcgg agaaggtata ccgcgccggt      1620
     ctggtggacc tgcacgctcg cgttaaggtt cgcatcaccg acagctacaa gaccgaagag      1680
     ggtgagatcg tcgaagagcg taagatcatc gacaccacca tcggtcgtgc catcctgtcc      1740
     atgatcctgc cgaagggcct gcctttcgcg ctgatcaacc aggacatggg caagaagccg      1800
     atctccgccg tactgaacag ctgctaccgt atcctcggtc tgaaatccac cgtgattttt      1860
     gctgaccagc tgatgtacac cggtttccac ttcgccaccg tttccggtac ctccgtaggt      1920
     atcaacgaca tggtgatccc ggatgccaag aaagagatcg ttgcctctgc cgaagaggaa      1980
     gtggctgaga tctccgagca gttccaggcc ggtcttgtga ccgccggtga gcgctacaac      2040
     aaagtgatcg acatctgggc cagcgccaac gagaaagtct ccaaggcgat gatggaaaac      2100
     ctcaaaaccg acaccgtgat caaccgtgac ggcgctgagg aagagcagaa gtcctttaac      2160
     agcatcttta tgatggcgga ctccggcgct cgtggtagtg ccgctcagat ccgtcagctg      2220
     gctggtatgc gtggcctgat ggccaagccg gatggctcca ttatcgaaac cccgattgtg      2280
     gcgaacttcc gtgaaggtct gaacgtacag cagtacttca tctccaccca cggtgctcgt      2340
     aagggtctgg cggataccgc actgaagacc gcgaactccg gttacctgac ccgtcgtctg      2400
     gtagacgtat cccaggatct ggtgatcgtt gagcaagact gtggttccgt ggaaggcatc      2460
     tccgttaagc cgctgattga aggcggtgac gtggttgagc cgctgcgcga gcgcgtactg      2520
     ggccgtgtgg ttgctcagga cgtcatcaag ccgggtaccg aagacgaagt gctgatcccg      2580
     cgtaacaccc tgctcgacga gaagtggtgt gacctgattg aagcgcactc cgtggacgaa      2640
     atcctggttc gctccgtgat cacctgtcag accgactttg gtgtgtgtgc tcactgttac      2700
     ggccgcgatc tggcccgtgg tcacctggtg gccgagggtg aagcgattgg tgttgttgct      2760
     gctcagtcca ttggtgagcc gggtacccag ctgaccatgc gtacgttcca catcggtggt      2820
     gcggcatctc gtgcctctgc cgagagcaac gtacaggtga agaacagcgg tatcctgaag      2880
     ctgcagaacg ccaagtacgt gaccaacgcc gacggcaaga tcgttgtgac ctcccgttct      2940
     accgaactgg cggttattga cgacctgggt cgcgagaagg agcgttacaa gctgccttac      3000
     ggtgctgttc tggacaagag cgaaggcgct gcggttgccg ctggcgacat cgttgccaac      3060
     tgggacccgc acactcaccc gatcatcacc gaggtggaag gtcgcattca gttcgttgac      3120
     atggtcgaag gcgttaccat gaccaagcag actgacgaac tgaccggtct gtccagcatc      3180
     gtgatcctcg acgttgccca gcgtaccagc gcgggtaaag agatgcgtcc gatggtgaaa      3240
     ctgatcgacg agtccggcaa cgacatcctg atcccgggca ccgaagtgcc ggcccagtac      3300
     ttcctgggtg gtcacgccat tgtgagcatc gacgacggta ccatggtacg cgtgggtgac      3360
     gctctggccc gtattccgca ggaatccggc ggtaccaagg atattaccgg tggtctgccg      3420
     cgcgtggccg acctgtttga agcccgtaag ccgaaagaac cggctatcct ggctgaaatc      3480
     accggtacca tctccttcgg taaagagacc aaaggtaagc gtcgcctggt gatcactccg      3540
     cacgacggcg gtcagccgta cgaggagatg attccgaagt ggcgtaacct gaacgtgttc      3600
     gaaggtgaaa aggttgaacg tggcgaagtg atcgctgacg gtccggaagc tccgcacgac      3660
     attctgcgtc tgcgcggcat ccacgctgta gcgaactaca tcgttaacga agttcaggac      3720
     gtataccgtc tgcagggtgt gaagattaac gataagcaca tcgaggtggt gatccgccag      3780
     atgctgcgta agtgcatcat cctcaacggt ggtgattccg agttcctggc tggcgagcag      3840
     gtggaagtgg cccgtgtaca tcaggccaac cgtctgctgg aagagcaggg caagcagccg      3900
     gcgacttacg agcgcgaact gctgggtatc accaaggcgt ctctggcgac cgagtccttc      3960
     atctctgcgg cctccttcca ggagaccacc cgcgtactga ccgacgctgc cacctacggc      4020
     aagcgcgacg atctgcgcgg tctgaaagag aacgtgaccg ttggtcgcct gatcccggct      4080
     ggtaccggtt acgcgtacca ccgcagccgt cagcagcagg cccaggaagc cgcccccgcg      4140
     gtgaccgctt ccgaagccga gcagaacctg gcggacctgc tgaacgccgc aggcccgaac      4200
     gaccagtaa                                                              4209
//

If you have problems or comments...

PBIL Back to PBIL home page