(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE253

CP002209.PE253       Location/Qualifiers
FT   CDS_pept        287307..287681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0253"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="COGs: COG0048 Ribosomal protein S12; InterPro
FT                   IPR005679: IPR006032; KEGG: vha:VIBHAR_00057 30S ribosomal
FT                   protein S12; PFAM: ribosomal protein S12/S23; SPTR: Q87L43
FT                   30S ribosomal protein S12; TIGRFAM: ribosomal protein S12;
FT                   PFAM: Ribosomal protein S12; TIGRFAM: ribosomal protein
FT                   S12, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74467"
FT                   /db_xref="GOA:E1SLR8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLR8"
FT                   /protein_id="ADN74467.1"
FT                   /translation="MATVNQLVRKPRKDKVKKTNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDT
FT                   AGVNDRRQGRSKYGAKRPKS"
     atggctactg ttaaccagct ggtacgtaag ccgcgtaagg acaaggttaa aaaaaccaac        60
     gttcctgcgc tggaagcgtg ccctcaaaaa cgtggtgttt gcactcgcgt atacaccacc       120
     accccgaaga agccgaactc tgcactgcgt aaagtgtgcc gtgttcgtct gaccaacggt       180
     tttgaagtta cctcctacat tggtggtgaa ggtcacaacc tgcaggagca ctccgtagtg       240
     ctgatccgcg gcggtcgtgt aaaagacttg ccgggtgttc gctaccacac tgttcgtggt       300
     gccctggata ccgccggtgt gaacgaccgt cgtcaaggtc gttccaagta cggcgctaag       360
     cgtcctaagt cttaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page