(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE258

CP002209.PE258       Location/Qualifiers
FT   CDS_pept        292719..293852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0258"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: rec:RHECIAT_PC0000842 putative
FT                   glycosyltransferase protein; PFAM: glycosyl transferase
FT                   group 1; SPTR: A3CTC6 Glycosyl transferase, group 1; PFAM:
FT                   Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74472"
FT                   /db_xref="GOA:E1SLS3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS3"
FT                   /protein_id="ADN74472.1"
FT                   /translation="MGQSNVVLVIFSYGMSATRWKQMGILSKEKVIFEAYLNSGLAEQV
FT                   VWFTYHPDDPALVAEEQKAGRLHPGITVLPAPAWAGTGLGKLFYSVAGPWLQRDAFTQA
FT                   TAMINHQTSGCWTGLTARLLLGGRFVYRYGHSLWRRHLDRKQYARLAFSWPLDRLALAC
FT                   SDHALVCTESDYRATSGGPNVSHCPNFIELESTARAHDAPSQRPNRGVYVGRLMSFKNL
FT                   FNLIEACAKRQLPLDLYGDGPLRGELEAHAAKVGAECRFLGVRPNHEVRDALTQYRWFF
FT                   LVSNYEAMPKALLEGMAAGCVCVAAPNYGCAEVIEDGVDGVLSADWEADSIADAMARAD
FT                   GPHMDGMASRAMTKVRDQYSLERVLSLHRKALLGGDQ"
     atggggcaga gcaacgtggt cctggtgatc ttctcctacg gcatgtccgc gacgcgctgg        60
     aaacagatgg ggatcctctc caaggagaag gtgatcttcg aagcctatct gaactcgggc       120
     ctggccgagc aggtagtgtg gtttacctat cacccggatg atcccgcgct ggtggccgag       180
     gagcagaagg cgggccggct gcatcccggc atcaccgtgc tgcccgcgcc agcctgggct       240
     ggaacggggc tgggtaagtt gttctactcc gtggcggggc cctggctcca gcgagacgcg       300
     tttacccagg ctacggcgat gatcaaccac cagaccagtg gctgctggac tggcctcacc       360
     gcccgactct tgcttggcgg ccgatttgtt taccgttatg gccactcact atggcgccgg       420
     cacctggacc gaaagcagta cgcccggctg gccttttcct ggccactgga tcgactggca       480
     ctggcgtgtt ccgaccacgc gctggtctgc actgaaagcg actatcgcgc cacgtccggt       540
     ggccccaacg tcagccattg tcccaatttt atcgagctgg aaagcacggc gagggcgcat       600
     gatgcgccct cgcaaaggcc caatcgtggg gtctatgtgg gccggctgat gtcctttaag       660
     aacctgttta acctgattga agcctgcgca aaacgccaat tgccgctgga cctctacggc       720
     gatggtccgt tgcgggggga gctggaggcg catgcggcca aagtgggtgc cgaatgccgg       780
     tttctggggg tgcggcccaa tcacgaagtg cgtgacgcgc tgacccaata ccgctggttt       840
     ttcctggtca gcaattatga agcgatgcct aaagccctgc ttgaggggat ggcggcgggg       900
     tgtgtctgcg tggctgcccc caactacggc tgtgccgagg tgattgaaga cggcgttgat       960
     ggagtattga gcgccgattg ggaggcggac agtatcgccg acgccatggc cagggccgat      1020
     gggccacaca tggatggcat ggccagtcgc gcgatgacca aagtgcggga tcagtactcg      1080
     ctggagcggg tactcagcct gcatcgcaaa gcgttattgg gcggtgacca atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page