(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE259

CP002209.PE259       Location/Qualifiers
FT   CDS_pept        293849..295144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PC0000848 hypothetical protein;
FT                   PFAM: O-Antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74473"
FT                   /db_xref="GOA:E1SLS4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS4"
FT                   /protein_id="ADN74473.1"
FT                   /translation="MSAVIATERTHPLAMLALAIFALFWCLAVTMVKLEAGLPVRVWVL
FT                   LLGLGWLATLYRVPWADLTRGNVHLSTLAGIAAVGMITTLWGTLDWPGTLLMVVKWVLQ
FT                   PALAFLFTVLIAHLYGVRVVVRIFFAVVALTAFVAVLQGLDFQPAWDLKYRFEQWQGLD
FT                   RAQIFAIEQESGGGAYQDQYRSRGLSYSPIHLGYQITLVVGLLYYASQRAPALNPLSPR
FT                   WTWALIALLFAAAVFSGTRSTIGGLLLLLPLHYLVCHKHRGVGVLLVTGLLLLAPVLFA
FT                   LASQLLDLRIFSTTDSSMQARVPLTMLGLKLFWDNPLGHGWLIEASDLADQYWHRLYHI
FT                   NNAEVVVYRGIHNHAVKMLFVYGLVGAGLLIYYLATLKRMFGVALLVALAPYGFHALFH
FT                   NDGIFLGGNYIWVWLGILHCYWMEQRRNDAAT"
     atgagcgccg tcatcgcgac tgagcgtacg cacccgctgg ccatgctggc gctggcgatc        60
     tttgccctgt tctggtgtct ggcggtgacc atggtcaagc tggaagccgg attgccggtg       120
     cgggtctggg tgctgctgtt ggggctgggc tggctggcga ccctctatcg tgtgccctgg       180
     gcagatctga cccgcggtaa cgtccatctg tccaccctgg ctggcatcgc ggctgtcggc       240
     atgatcacga cgctgtgggg cacgctggat tggccaggta ccctgcttat ggtggttaag       300
     tgggtgcttc agcctgctct ggcgtttctg tttactgttc ttattgccca cctctatggg       360
     gtccgggtgg tggtgcggat cttctttgcc gtggtggcgc tgaccgcgtt tgtcgcggtc       420
     ctgcaggggc tcgattttca gcccgcgtgg gacctgaaat accggtttga acagtggcag       480
     ggtttggatc gggcgcagat ctttgcgatt gaacaggagt ccggaggcgg cgcctatcag       540
     gaccagtatc gctcgcgagg cttgtcctac tctccaatcc acctcggcta tcagatcacg       600
     ctggtggtgg ggttgctcta ctacgcttcc cagcgagcac cggcgctcaa ccctctgagc       660
     cctcgctgga cctgggcgct gatcgcgctg ctgttcgcgg ccgcggtgtt ctccggcacc       720
     cgttccacca ttggcggcct gttgctgctg ttgcccctgc attatctggt ttgccacaag       780
     catcgtgggg tgggcgtatt gctggtgacc ggactgttgt tgctggcgcc ggtgttgttc       840
     gcattggcgt cacagctgct ggacctgagg atcttcagta ccaccgattc cagcatgcag       900
     gcccgcgtac ctctgaccat gcttgggctg aaactgttct gggataaccc gttggggcac       960
     ggctggctga ttgaggcgag tgacctcgct gaccagtatt ggcaccggct ttaccacatc      1020
     aataacgccg aagtggtggt gtatcgcggc atccataatc acgccgtgaa gatgctgttt      1080
     gtctatgggc tggtgggcgc cggcctgctc atctattacc tggccacgct caagcggatg      1140
     tttggggtgg ccctgctggt tgccttggca ccttatgggt ttcatgcgct gtttcataac      1200
     gacggcatct tcctaggcgg caactacatc tgggtgtggc tgggcattct tcactgttac      1260
     tggatggagc aacggcgcaa tgacgcagcg acttaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page