(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE26

CP002209.PE26        Location/Qualifiers
FT   CDS_pept        31725..32204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0026"
FT                   /product="protein of unknown function DUF494"
FT                   /note="COGs: COG2922 conserved hypothetical protein;
FT                   InterPro IPR007456; KEGG: cps:CPS_0023 smg protein; PFAM:
FT                   protein of unknown function DUF494; SPTR: Q48AU5 Protein
FT                   smg homolog; PFAM: Protein of unknown function (DUF494)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74240"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV86"
FT                   /protein_id="ADN74240.1"
FT                   /translation="MIMFDILMYLFETYVQSDVELLFDREELTDELSRAGFRSDEIGKA
FT                   LIWIEKLAALQDSDRHPYLTGVEPGSFRIYTAEEVARLDTESRGFLMFLEQIQVLSATT
FT                   REMVIDRVMELDGEPLSLDDLKWVVLMVLFNAPGNEQAYTQMEDLIFEEPEGLLH"
     atgattatgt tcgacatttt aatgtacctg tttgagacct atgtacagag cgatgttgaa        60
     cttttgttcg accgcgaaga gttgaccgat gaattgagcc gggctggctt tcgttccgac       120
     gagattggca aagcgctgat ctggatcgaa aagctggcgg cattgcagga ttcggaccgc       180
     cacccctatc tcaccggcgt agagcccggc agtttccgga tctacaccgc tgaagaggtg       240
     gctcgtctcg acactgaaag tcggggcttc ctgatgttcc tggagcagat ccaggtactc       300
     tccgccacca cccgtgaaat ggtgattgac cgggttatgg agctggatgg agaaccgttg       360
     tcactggatg acctgaaatg ggtggtactg atggtgctgt tcaatgcccc gggcaacgaa       420
     caggcttaca cccagatgga agacctgata tttgaggagc cggaagggct gctccactaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page