(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE260

CP002209.PE260       Location/Qualifiers
FT   CDS_pept        295128..296243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0260"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: gur:Gura_2587 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A3HV85
FT                   Glycosyltransferase-like protein; PFAM: Glycosyl
FT                   transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74474"
FT                   /db_xref="GOA:E1SLS5"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS5"
FT                   /protein_id="ADN74474.1"
FT                   /translation="MTQRLKVAWLGGRGYHSSYGGVENAIRELAKESVRIPDIEPWVAG
FT                   RGKGWWFQRTEQDGVHLLEAPKWLGRLGHALCTLGLLLYTIVRIRPDTLFLFASGPSLL
FT                   SVIGRLFGAHTVACLRAIDSQRDGWRGLNQKVLELGEYAATHIAHQCTVNSLAMQRYFA
FT                   ARQLDTIYIPNGITPLAEPIPGYLERLGLEPEGYLLYAGRLDPVKRLDVLLQAHRQLPP
FT                   ESRPMLVVAGGKCKSQEYQTKLEQMASDDVLFLGHVGQRELSTLMASCSLFVLPSVLEG
FT                   MSNSLLTAMGAGRPVLCADVPENADVVASDPRVLFEADNVADLLAQLQAHLDQAERRVE
FT                   VAKTIKSLSANYSWRQSAAAFCQLAREGRGG"
     atgacgcagc gacttaaggt ggcctggctg ggaggacggg gttaccactc cagttacggg        60
     ggggtggaga acgccatccg cgagctggcg aaagagagcg tacggatccc cgatattgag       120
     ccctgggtcg cgggcagggg caaaggctgg tggtttcagc gcactgaaca ggacggtgtt       180
     cacctgctgg aggcgcccaa gtggcttggg cggctgggcc atgcgctctg tacactcggg       240
     ctgttgcttt acaccatcgt caggatccgg cccgacacgc tgtttctgtt tgcctccggg       300
     cccagcttac tgtccgtgat aggccggttg ttcggggccc acaccgtcgc ctgcctgcgt       360
     gccatcgaca gccagcggga tgggtggcgc ggcctgaatc agaaggtatt ggagctgggt       420
     gagtacgccg cgacgcacat cgcccaccag tgcacggtga acagcctggc gatgcagcgc       480
     tactttgcgg ctcggcagct ggacaccatc tacatcccca acgggattac ccctttggcg       540
     gagccgatcc ccggttatct ggaacggctg gggttggagc cggaagggta cctgctctat       600
     gccggccggc ttgacccggt gaagcgcctc gatgtgttgc tgcaggccca tcgacaactg       660
     ccgccagagt cccggccaat gctggtggtg gcgggcggta agtgcaagtc tcaggaatac       720
     cagactaagc tggaacagat ggcgtcggat gatgtgctgt ttctgggcca cgtcggacag       780
     cgggagttat cgaccctgat ggccagttgc agcttgtttg tcctgccctc ggtgctggag       840
     gggatgtcca acagcctgct gaccgcaatg ggggcgggac gtccggtatt gtgtgccgac       900
     gtgccggaaa atgcggatgt cgttgccagc gatccgaggg tgctgtttga agccgacaac       960
     gtggcggatc tgctggctca gttacaagcc caccttgacc aggccgagcg ccgggtcgag      1020
     gtggcaaaaa ccatcaagtc cttatcggcc aactacagtt ggcgtcagtc cgccgcagcg      1080
     ttctgccagc ttgcgcgcga ggggagggga ggatga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page