(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE263

CP002209.PE263       Location/Qualifiers
FT   CDS_pept        298867..303123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0263"
FT                   /product="Kelch repeat protein"
FT                   /note="InterPro IPR011498: IPR006652; KEGG: actin binding
FT                   protein ; K10442 kelch-like protein 1/4/5; PFAM: Kelch
FT                   repeat protein; Kelch repeat-containing protein; SMART:
FT                   Kelch repeat-containing protein; SPTR: A9A4Q1 Kelch repeat
FT                   protein; PFAM: Kelch motif"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74477"
FT                   /db_xref="GOA:E1SLS8"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR024361"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLS8"
FT                   /protein_id="ADN74477.1"
FT                   /translation="MLSLFRGRFGALLALLFLSFSLHAELRVSQLPDKSVSEPLNGAEI
FT                   SGTVYIFYQPSQPLSQVKFYLDTAVGGKTFQTENIAPYDFAGTASGGAGNPFDADSLSG
FT                   GSHTIAVLVTPQSGSAFEASATFTVGDGGGGTTPTLNFASDSQSFSVTGEQQQTGSVAL
FT                   SLSDGSSATANLSSSASWLTLDSSTQAVPGSVGFQVDSTGLGVGSYSATITASVTGYPS
FT                   VSHGVSLTVLSSGSSGYSLLVSTQPDRSGAVPLGGQSLSGPVYIFTSPDNGVSKVRFYL
FT                   DNPGLSGSSTKTEGVAPYDFAGTAPDRTAYPFNVDGLSDGLHTIDVELVTTNGSQYTQG
FT                   SFVVGEEVVSLLASPTSISLSGEIDSGILSATAQVTASDGSNLVFSEEHDAAWLSLDLG
FT                   GDSTPATVTFSVDTNGLSAGSYSDTVTLFSTGVGSAQVTVALTLTDPNGGGGGGGGGTG
FT                   ELCGPVLCSDVKVTLPYVLEFDDSVEGYLDGNGIGTGFTYLQPTSKGSGYLPDNLDVNT
FT                   STERLVVTTTKGLQHQSINNLDNALGVGYAGPNHIARISTVLVEPPAGSGKYEQAGLWF
FT                   GYDEDHFIKLVYNSAGGGPVVEFIYESAGSVQGKFDANVGDLSSDTLTLALVANPETQS
FT                   ISARYSINGGSETNLGSFDIAPEFFSFDAAGIDPVIGTRTFTGIMASHRNGASALVYQF
FT                   ESFSVESLGAPGSGGGGSGGGGSGGGSADWSFSKVSSHPLDFPTAMVWGPDNRLYVTEL
FT                   FGTIHALTFDDQLRVVDDQVITGLTDRHGSRMTLGIEVYHDDPSDPNGFSLWVNHSSAS
FT                   TNNGIINSGEVTRLFGDNFAESEVVISGLPRAKANHGPNSLHFGPDNRLYIAIGGITGA
FT                   GAAVDPNVANTEFGDRAEQPLSAAILVADVFAAGFDGTCDNSPDIFGPNPCDVVTWVTG
FT                   LRNTYDFVFHSNGQAYATDNGLGVKGAYPPKPTPDCSGFGDPAPYDEGGDNPGTQPDLL
FT                   LKLEAGEYYGHPNPTRDECVFKDGSYQNVAPLPNYQPEIFSLGNNKSANGIVELRSNRA
FT                   CGALNGDLMVTYYSKDDGVTRLQLNADGDQVVLAEKLFADLVDPLPLAARNGDIYVGEF
FT                   GAGVVSVLALASTPCWDAGADAPAELLDSGSAILNGKLHVVGGKTASGHVNTHYAYDIG
FT                   ADSWQTLAAKPGTAVENGAVAAYNGALYVFGGSSGPFNGAVTESYRYDPGSNSWQALAP
FT                   MPVALGGIRAEAIGDEIYIAGGMNGSGASVASLLVYDPGSNSWRTGPSMSQVRDNPGTA
FT                   VLNGELYVLGGRHRLADGTSLDGQLNTMEIYNPSSNQWRRGPDLLTGRRTFAVGTINGR
FT                   IQVLGGEYASGVTNNVFPQYEEFDPGSNQWQYLGDALFPTHGAAFGTFGDQLILSTGGP
FT                   IGGTSFSNDTYRVSGQ"
     atgctaagtc ttttccgtgg acgttttggg gccctgttgg ctctgctgtt tctgagtttt        60
     tcccttcacg ccgaactgcg tgtcagtcag ttgcccgata agagcgtttc tgaacctctt       120
     aatggcgcag agatcagtgg cacggtttac atcttctacc agccctccca gcctctgagc       180
     caggtgaagt tctatctgga tacggcggtg ggcggaaaga ccttccagac cgaaaacatc       240
     gctccctatg attttgccgg taccgccagt ggtggtgcgg gtaacccctt cgatgcagac       300
     agcctgtcag gcggcagcca caccattgcg gtgttggtga ccccgcaaag tggcagcgcc       360
     tttgaagcct cggccacctt taccgtgggt gacggcgggg gagggaccac cccgaccctg       420
     aactttgcct ccgactccca aagcttcagc gtcactggtg aacaacagca aaccggttcc       480
     gtggcgttgt ccctgagcga tggcagctcg gcgacggcca acctgtcgag ctccgccagt       540
     tggcttaccc tggacagttc gactcaggcg gtgccgggca gcgtgggatt ccaggtggac       600
     tccaccggcc ttggggtcgg cagctacagc gccaccatta cggcttcggt gaccggctat       660
     cccagcgtca gccatggggt gtccctgacg gtactcagca gtggcagcag cggctacagc       720
     ctgctggtca gtactcagcc tgatcgcagc ggcgccgtgc cgctgggtgg ccagagcctc       780
     agcggaccgg tttacatctt tacctcaccg gataatggcg tcagtaaagt ccgcttctac       840
     ctggataacc cgggtctgag cggttcctcc actaagaccg aaggggtggc accctacgac       900
     ttcgcgggga cggcgccaga tcgtacggca taccccttca acgtggatgg cctgtctgat       960
     gggctgcaca ccattgatgt cgagctggtg accaccaacg gcagccaata cacccagggc      1020
     agctttgtgg tgggtgaaga ggtggtttcc ctgctggcgt caccgacctc cattagcctc      1080
     tccggtgaga tcgacagcgg catcctgtcg gcgaccgcgc aggtcaccgc atcggatggc      1140
     agtaacctgg tgttcagtga ggagcacgat gcggcctggc tcagcctgga tctgggcggc      1200
     gacagcacac cggccaccgt gactttcagt gtggatacca acggcctcag tgctggcagc      1260
     tattccgata ccgtgactct gttctcaacc ggagtgggct cggcccaggt cacggtggcc      1320
     ctgactctga ccgacccgaa cggcggtggg ggcggcggtg gtggaggcac cggtgagctc      1380
     tgtggcccgg tgctctgcag tgacgtgaaa gtgacgctgc cttacgtcct tgagtttgat      1440
     gactcggtag agggctacct cgatggcaac ggcatcggca ccggtttcac ctacctgcag      1500
     ccgaccagca aaggcagtgg ctatctgccg gataacctgg atgtgaacac ctccaccgaa      1560
     cggttggtgg tgaccaccac caaagggctg caacaccaga gcatcaacaa cctcgataac      1620
     gcattgggtg tgggctatgc cggccccaat cacatcgccc gcatcagtac agtgctggtg      1680
     gagccgcctg cgggttccgg caagtatgaa caggccggtc tgtggttcgg ctatgacgaa      1740
     gaccacttta tcaagctggt gtacaactcc gccggcggtg gtccggttgt tgagttcatc      1800
     tatgagtccg ccggttcggt gcagggtaag ttcgacgcta acgtgggcga tctgtccagc      1860
     gataccctga ccctggccct ggtggccaac ccggaaaccc agagcatcag tgcccgctac      1920
     agcattaatg gcggcagtga aaccaacctg ggcagctttg atatcgcgcc agagttcttc      1980
     agctttgatg cggccggtat cgatccggtt atcggtaccc gaacctttac cgggatcatg      2040
     gccagccacc gtaacggcgc cagtgcactg gtgtaccagt tcgagtcgtt ctctgtggag      2100
     agcctgggtg caccgggaag tggtggcggt ggctcgggtg gtggcggttc cggtggtggc      2160
     agcgcggact ggagctttag caaggtcagc agccacccgc tcgacttccc cactgcgatg      2220
     gtctggggcc cggataaccg actctatgtc accgagttgt ttggcaccat ccatgccctg      2280
     acctttgatg atcagttgcg ggttgtggat gaccaggtga tcaccggtct gaccgatcgt      2340
     cacggttcaa ggatgacgct gggcatcgag gtgtaccacg atgacccatc ggatcccaat      2400
     gggttctcgc tgtgggtgaa ccactccagt gcctccacca ataacggcat cattaattcc      2460
     ggtgaagtga cccggctgtt cggtgacaac tttgccgagt cggaggtggt gatcagcggc      2520
     ctgccgcggg ccaaggccaa ccacggcccc aacagtctgc acttcggtcc ggacaaccgg      2580
     ctctacattg ccattggtgg cattaccgga gcgggtgcag cggtagaccc caatgtggcc      2640
     aacacggagt ttggtgaccg ggccgagcag cccttatcgg cggcgatcct ggtggcggat      2700
     gtgtttgccg cgggctttga tggcacctgc gacaacagcc ccgacatctt cggtcctaat      2760
     ccctgtgatg tggtgacttg ggtgaccggg ctgcgtaaca cctatgactt tgtgttccac      2820
     agcaatggtc aggcgtacgc gaccgataat ggcctcgggg tgaaaggggc ttatccgccc      2880
     aagccgacac cggattgcag tggctttggt gaccctgctc cctacgatga ggggggcgac      2940
     aaccctggca ctcaaccaga tctactgctg aagctggaag cgggagagta ctacggccac      3000
     cccaacccga cccgtgacga gtgtgtcttt aaggacggca gttaccagaa cgtggcaccg      3060
     ttgccgaact accagcctga gatcttctcg ctgggcaaca acaagtcggc caacggcatc      3120
     gtcgagcttc ggtctaaccg cgcctgcggt gcgctcaatg gcgacctgat ggtgacctac      3180
     tactccaagg atgatggcgt tacccgcctg cagctgaatg ctgacggcga tcaggtggtg      3240
     ctggcggaga aactgtttgc ggacctggtg gaccctctgc cgctggcggc acgcaatggc      3300
     gacatctatg tcggtgagtt tggtgcgggc gtggtatcgg tactggccct ggccagtacc      3360
     ccatgctggg atgccggcgc ggatgccccg gcagagctgc tcgacagtgg cagtgccatt      3420
     ctgaacggca agttgcacgt ggtgggtggc aaaaccgcgt ccggacacgt caacacccat      3480
     tatgcctatg acatcggtgc cgacagttgg caaaccctgg ccgcgaaacc gggtaccgcc      3540
     gttgagaatg gtgcggtcgc cgcttacaac ggtgcgcttt acgtgtttgg cggttcttcc      3600
     ggtcccttca atggcgcggt caccgaaagc tatcgctatg acccgggcag caacagctgg      3660
     caggcattgg cgcccatgcc ggtggcactg ggcgggatcc gggcggaagc catcggtgat      3720
     gagatctata tcgccggcgg catgaatggc agcggtgcct cagtggccag ccttctggtc      3780
     tatgacccgg gcagcaacag ctggcggacc ggaccgagca tgagccaggt cagggataac      3840
     ccgggtacgg cggtccttaa tggtgagctg tatgtgctgg gcggacgtca tcgtttggct      3900
     gatggcacta gcctggatgg ccagctcaat acgatggaga tctacaaccc gtccagtaac      3960
     cagtggcgac ggggaccgga cctgctgacc ggacgccgga cctttgcggt aggcaccatc      4020
     aatggacgga tccaggtcct tggcggcgag tacgccagtg gcgtcaccaa caacgtgttc      4080
     ccgcagtacg aggagttcga cccgggcagc aatcagtggc aataccttgg ggatgcgctg      4140
     ttcccgaccc acggggccgc atttggcacc ttcggggacc agctgattct gtcgacgggg      4200
     ggccccatcg gtgggacgtc gttcagtaat gacacctacc gggtgtcggg acaataa         4257
//

If you have problems or comments...

PBIL Back to PBIL home page