(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE266

CP002209.PE266       Location/Qualifiers
FT   CDS_pept        305829..306350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0266"
FT                   /product="polysaccharide export protein"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR019554: IPR003715; KEGG:
FT                   amc:MADE_02478 periplasmic protein involved in
FT                   polysaccharide export; PFAM: polysaccharide export protein;
FT                   Soluble ligand binding domain; SPTR: A3GYZ0 Capsular
FT                   polysaccharide synthesis enzyme CpsC polysaccharide export;
FT                   PFAM: Polysaccharide biosynthesis/export protein; SLBB
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74480"
FT                   /db_xref="GOA:E1SLT1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT1"
FT                   /protein_id="ADN74480.1"
FT                   /translation="MKWWIACLWLVCSAVSANDAAGYLLGPGDQIRIQVFGEPDLSISE
FT                   IRLGESGSISYPYLGQIRLSGLRLSQVEQLIHKGLKGDYLINPSVSVSIVEYRPFFING
FT                   EVRRPGGYPFQPGLTVRKAVALAGGLTERASSRDISLTRKTPNGERIIEVSMASEVQPG
FT                   DSIYIEDSFF"
     atgaagtggt ggattgcgtg tttgtggctg gtgtgttcgg cggtatcagc caacgatgcc        60
     gcgggatacc tattgggccc gggcgatcag atccggatcc aggtatttgg agagccggac       120
     ctgagcatct ccgaaatccg tctgggtgaa tccggcagca tctcctatcc ctacctgggc       180
     cagatacgcc tttccgggct gcgcctgagc caggttgagc agctgatcca taagggcctg       240
     aaaggggact acctgatcaa ccccagcgtc tcggtgagca tcgtcgagta ccgtcccttc       300
     tttatcaacg gtgaagtacg ccgtccgggt ggctatccct ttcagccagg gctgaccgtg       360
     cgcaaagcgg tggcgctggc gggcggttta accgagcggg cgtcctccag ggacatctca       420
     ctgacccgca aaaccccaaa tggtgaacgc attatcgaag tctctatggc ctcagaggta       480
     cagccagggg attccatcta catcgaagac tcattcttct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page