(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE27

CP002209.PE27        Location/Qualifiers
FT   CDS_pept        complement(32246..33934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0027"
FT                   /product="Microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="InterPro IPR002169: IPR013510; KEGG: slo:Shew_3732
FT                   collagenase; PFAM: Peptidase M9A collagenase domain
FT                   protein; PRIAM: Microbial collagenase; SPTR: A2PRY4
FT                   Collagenase; PFAM: Collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74241"
FT                   /db_xref="GOA:E1SV87"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV87"
FT                   /protein_id="ADN74241.1"
FT                   /translation="MRLLLPLALTGLLGACTTLPQPQPVTLTNWQQPDPAQLPLALDNL
FT                   SRGEAEPALDYLRAFSYFGDPDTLTEAQQQQLHSAMLAQGKSLDALAEPRLAEQWAVAF
FT                   YRYYGQEAMQPYAEALLPSLIRQLDRFAEQAPQTLAQEYALWELLRAPGLLMHQVRRKD
FT                   AENPLHAALTERELTEALTRYAASAGAHYQGQDWPLQNAYWVLAHQRLLLSEEKGEAQD
FT                   QAVAAIARQDLSQRGDAAKTAFTLGYLVNAFLGQEACKETYGDLCAIPEPEAVLPITHA
FT                   CTERLVIRTQDLNEAELAESCDKLTSQEDHFHQLLGTGMTPVVNDYNTALEVVVFKNWS
FT                   QYNAYGQLLFDISTDNGGMYIEGTPQAEGNQARFFAFRGWWLPEFNVWNLNHEYIHYLD
FT                   GRYIKYGGFGHFPGQMVWWAEGMAEYISKGEDNRQAQKLLQDTDPAEWPSLETIFATEY
FT                   DDGLDRTYRWSYMAVRYLAEQAPDSLVAITKPLKGDYAEGYATILSDTAEAHQAGFSQW
FT                   LTEWAAAPLPEEADASPYPRKLNRYGYRDYLRPAQLANSEGHLHF"
     atgcgtttac ttctccccct ggccctaacc ggcctgctgg gcgcctgtac caccctgcct        60
     caaccccaac cggttacgct caccaactgg cagcaaccgg acccggccca actgccactg       120
     gcactcgata acctgagccg gggcgaagcc gaaccggcac tggattacct gcgcgccttc       180
     tcctatttcg gtgatcccga caccctgacc gaagcgcaac agcagcaact gcacagcgcg       240
     atgctggctc agggcaaatc cctcgatgca ctggctgagc cccgtcttgc cgaacagtgg       300
     gcggtggcgt tctaccgcta ctacggtcag gaagcgatgc agccttatgc tgaagcgctc       360
     cttcccagcc tgatccgcca actggaccgc ttcgctgaac aggcaccgca aaccttggct       420
     caggagtacg ccctatggga actgctgcgt gcccccggcc tgctgatgca ccaggtgcgt       480
     cgcaaagacg ctgagaatcc gctgcacgct gccctgacgg aacgtgagct gaccgaggcc       540
     ctgacccgct acgccgccag cgccggtgcc cactatcagg gccaggactg gccgctgcag       600
     aacgcctact gggtactggc ccaccagcgc ctgttgctgt ccgaagagaa gggcgaagcc       660
     caggatcagg ccgtggctgc catcgcccgc caggatctca gccaacgcgg tgacgcagcc       720
     aaaaccgcct ttaccctcgg ttatctggtc aacgccttcc tgggtcagga agcctgcaaa       780
     gagacctatg gcgacctgtg cgccatcccc gagccggaag cggtattgcc catcacccac       840
     gcttgtaccg aacgcctggt gattcgaact caggatctca atgaagccga attggccgaa       900
     agctgcgaca agctgacctc ccaggaggat cacttccacc agctgctggg caccggcatg       960
     accccggtgg tcaacgacta caacaccgca ctggaagtgg tggtgtttaa gaactggagc      1020
     cagtacaacg cctacggcca gctgctgttt gatatcagca ccgacaacgg tgggatgtac      1080
     attgagggca cgccgcaggc ggagggcaac caggcccgct tctttgcgtt ccgtggttgg      1140
     tggttgccgg agttcaatgt ctggaatctg aaccacgagt acatccacta tctcgacggt      1200
     cgctacatca agtacggcgg cttcgggcac ttccccggcc agatggtgtg gtgggctgaa      1260
     gggatggcgg aatacatctc aaagggtgag gacaaccgcc aggcccagaa gctgctgcag      1320
     gataccgatc cggcggagtg gccgagtctg gagaccatct ttgccaccga atatgacgac      1380
     gggctggacc gcacctaccg ctggagctac atggcggtgc gttacctggc agagcaggcg      1440
     cccgacagcc tggtggcgat caccaagccg cttaaagggg attacgccga agggtacgcc      1500
     accatcctga gtgacactgc cgaggcccac caggccggct tcagccagtg gctgacggag      1560
     tgggcagcag caccgctgcc agaagaggcg gatgcctcgc cctacccgcg caagctgaac      1620
     cgctatggct accgtgacta cctgcgtccg gcacagctgg ccaacagtga aggtcacctt      1680
     cacttctga                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page