(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE272

CP002209.PE272       Location/Qualifiers
FT   CDS_pept        310829..311653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0272"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="COGs: COG0090 Ribosomal protein L2; InterPro
FT                   IPR002171: IPR005880; KEGG: vch:VC2593 50S ribosomal
FT                   protein L2; PFAM: ribosomal protein L2; SPTR: A3H4S9 LSU
FT                   ribosomal protein L2p (L8e); TIGRFAM: ribosomal protein L2;
FT                   PFAM: Ribosomal Proteins L2, RNA binding domain; Ribosomal
FT                   Proteins L2, C-terminal domain; TIGRFAM: ribosomal protein
FT                   L2, bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74486"
FT                   /db_xref="GOA:E1SLT7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLT7"
FT                   /protein_id="ADN74486.1"
FT                   /translation="MAIVKCKPTSAGRRHVVKVVNNELHKGKPHAALLDKKSKTGGRNN
FT                   AGRITTRHIGGGHKQHYRIIDFKRNKDGITAKVERLEYDPNRSANIALVLYADGERRYI
FT                   LAPKGLQAGDTIVSGQEADIKVGNALPMRNIPVGSTVHNVELKPGKGGQIARSAGAYAQ
FT                   IVARDGAYVTLRLRSGEMRKVLAEGRATLGEVGNSEHMLRQLGKAGAMRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVTPWGVPTKGKKTRSNKRTDKYIVRRRTK"
     atggctattg ttaagtgtaa gcctacctct gcgggtcgtc gccacgtcgt taaggtcgtg        60
     aacaacgagc tgcacaaggg taagccccac gctgctctgt tggacaagaa gtccaagact       120
     ggtggtcgta acaacgccgg ccgcatcacc actcgccaca tcggcggtgg tcacaagcag       180
     cactaccgta tcatcgactt caagcgcaac aaagatggca tcactgccaa agttgagcgc       240
     ctggaatacg atccgaaccg cagcgctaac atcgctctgg ttctgtacgc cgacggtgag       300
     cgtcgttaca tcctggcccc gaaaggtctg caagctggtg acaccatcgt gtctggccag       360
     gaagctgaca tcaaagtggg caacgctctg ccgatgcgca acattccggt aggttctacc       420
     gtgcacaacg ttgaactgaa gcctggtaaa ggcggtcaga tcgcacgttc tgccggtgct       480
     tacgcccaaa tcgttgctcg cgacggtgct tatgtaaccc tgcgtctgcg ctccggcgag       540
     atgcgcaagg tgctggccga aggccgtgcc accctgggtg aagtaggtaa ctccgagcac       600
     atgctgcgtc agctgggtaa agctggtgcc atgcgctggc gtggtgttcg tccgaccgtt       660
     cgtggtgttg ccatgaaccc ggttgatcac ccgcacggtg gtggtgaagg tcgtacttct       720
     ggtggtcgtc acccggtaac cccgtggggc gttccgacca aaggtaagaa gacccgcagt       780
     aacaagcgta ccgataagta catcgtacgt cgtcgtacca agtaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page