(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE277

CP002209.PE277       Location/Qualifiers
FT   CDS_pept        313416..313607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0277"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="InterPro IPR001854; KEGG: vha:VIBHAR_00738 50S
FT                   ribosomal protein L29; PFAM: ribosomal protein L29; SPTR:
FT                   A7N0I5 50S ribosomal protein L29; TIGRFAM: ribosomal
FT                   protein L29; PFAM: Ribosomal L29 protein; TIGRFAM:
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74491"
FT                   /db_xref="GOA:E1SLU2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU2"
FT                   /protein_id="ADN74491.1"
FT                   /translation="MKAQDLREKSVEELNAELLNLLREQFNLRMQNATGQLKATHEMKK
FT                   VRRNIARVKTVLTQKAGA"
     atgaaagcac aagatctgcg tgaaaagagc gttgaagagc tgaatgctga gctgctgaac        60
     ctgctccgcg aacagttcaa cctgcgtatg cagaacgcta ccggtcagct gaaagcgact       120
     cacgaaatga agaaggtacg ccgcaacatc gcgcgcgtta agaccgttct gactcagaag       180
     gcaggtgcgt aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page