(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE28

CP002209.PE28        Location/Qualifiers
FT   CDS_pept        34048..34614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0028"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="COGs: COG0551 Zn-finger domain associated with
FT                   topoisomerase type I; InterPro IPR013498; KEGG:
FT                   shm:Shewmr7_0031 DNA topoisomerase type IA Zn finger
FT                   domain-containing protein; PFAM: DNA topoisomerase type IA
FT                   zn finger domain protein; SPTR: A2V466 DNA topoisomerase,
FT                   type IA, zn finger; PFAM: Topoisomerase DNA binding C4 zinc
FT                   finger"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74242"
FT                   /db_xref="GOA:E1SV88"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV88"
FT                   /protein_id="ADN74242.1"
FT                   /translation="MSKIDQQLFTTHEHALEREYGVCPECGSELAVRHGKHGAFLGCQS
FT                   YPTCEYHRPLVEKTTVEAEILEGTECPLCGHPLALKSGRYGFYIGCSDFPQCHYIAKDE
FT                   PETPATKVACPSCRSGELMERTNRFGKKFYACSGYPKCKYLLNFPPVAEPCPDCGWPLL
FT                   VEKNVRGQRRWVCPQRSCKYQSETI"
     atgtccaaga tcgaccagca gctgttcacg acccacgaac atgccctgga acgggaatac        60
     ggtgtttgcc ctgaatgcgg cagcgaactg gctgtgcgcc acggtaagca cggcgccttc       120
     ctgggctgcc aaagctaccc cacctgtgaa taccaccgtc ccctggtgga gaaaaccaca       180
     gtagaagccg agatcctcga gggcactgag tgcccgctgt gtgggcaccc cctggccctc       240
     aagtcgggac gctacggttt ctacatcggg tgcagtgact ttccccagtg tcactacatt       300
     gccaaggatg agcctgaaac gccggccact aaggttgcgt gcccaagctg tcgaagcggt       360
     gagttgatgg agcgaaccaa ccggtttggc aagaagttct acgcttgcag cggttaccca       420
     aaatgcaagt atttgctcaa tttcccgccg gtagcggagc cctgtcccga ctgtggatgg       480
     ccgctgctgg ttgagaaaaa cgtgcgtgga cagcggcgtt gggtctgccc ccagcgttca       540
     tgcaaatatc agtctgagac gatataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page