(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE280

CP002209.PE280       Location/Qualifiers
FT   CDS_pept        314399..314713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0280"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="COGs: COG0198 Ribosomal protein L24; InterPro
FT                   IPR005824: IPR005825: IPR003256; KEGG: swp:swp_2022 50S
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   domain protein; SPTR: B8CNE4 50S ribosomal protein L24;
FT                   TIGRFAM: ribosomal protein L24; PFAM: KOW motif; TIGRFAM:
FT                   ribosomal protein L24, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74494"
FT                   /db_xref="GOA:E1SLU5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU5"
FT                   /protein_id="ADN74494.1"
FT                   /translation="MAAKIRRNDEVIVLAGKDKGKRGKVSQVLTTGKIVVEGVNLVKKH
FT                   QKPNPQLGVQGGIVEKEAPIHASNVALFNPATGKADRVGFRFEDGKKVRFFKSNDEIVK
FT                   "
     atggcagcaa aaatccgtcg caatgacgaa gtgattgtac tggccggtaa ggacaagggt        60
     aaacgcggta aggtttccca agtactgacc actggtaaga tcgtcgtcga aggcgtgaac       120
     ctggtgaaga aacaccagaa gccgaacccc cagctgggtg ttcaaggtgg catcgtagag       180
     aaggaagccc ccatccacgc gtctaacgtg gcactgttca accctgctac tggcaaggct       240
     gaccgtgtgg gtttccgatt tgaagacggc aagaaagtcc gtttcttcaa gtccaacgac       300
     gaaatcgtta agtaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page