(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE281

CP002209.PE281       Location/Qualifiers
FT   CDS_pept        314728..315267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0281"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="COGs: COG0094 Ribosomal protein L5; InterPro
FT                   IPR002132; KEGG: asa:ASA_4075 50S ribosomal protein L5;
FT                   PFAM: ribosomal protein L5; SPTR: A4SSZ4 50S ribosomal
FT                   protein L5; PFAM: ribosomal L5P family C-terminus;
FT                   Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74495"
FT                   /db_xref="GOA:E1SLU6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLU6"
FT                   /protein_id="ADN74495.1"
FT                   /translation="MAKLHDYYKEAVVKELMQQFGYKSIMQVPRIEKITLNMGVGEAVA
FT                   DKKVLENAVADMAAISGQKPLVTKARKSVAGFKIREGYPIGCKVTLRGERMWEFFERLV
FT                   SIAVPRIRDFRGLNPKAFDGRGNYSMGVREQIIFPEIDYDKIDKLRGMDITITTSAGSD
FT                   EEGRALLAAFNFPFRK"
     atggcgaaac tgcatgatta ctacaaagaa gctgtagtaa aagagctgat gcagcaattc        60
     ggctataaga gcatcatgca agtccctcgg attgaaaaga tcaccctgaa catgggtgtc       120
     ggtgaagccg tagcggacaa gaaggtgctg gaaaatgccg ttgctgatat ggcagcaatt       180
     tccggtcaga aacctctggt taccaaagct cgcaaatctg ttgctggctt taagatccgt       240
     gaaggttacc cgattggctg taaagtaacc ctgcgcggcg agcgtatgtg ggagttcttc       300
     gagcgcctgg tgtccatcgc ggtaccgcgt atccgtgact tccgtggcct gaacccgaaa       360
     gcgttcgatg gccgtggtaa ctactccatg ggcgttcgtg agcaaatcat cttcccggaa       420
     atcgattacg acaagatcga taagctgcgc ggtatggata ttaccattac cacttccgcc       480
     ggctctgacg aggaagggcg tgctctgctg gctgccttta acttcccgtt ccgcaagtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page