(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE286

CP002209.PE286       Location/Qualifiers
FT   CDS_pept        316915..317415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0286"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="COGs: COG0098 Ribosomal protein S5; InterPro
FT                   IPR013810: IPR005324: IPR018192: IPR005712; KEGG:
FT                   sfr:Sfri_0165 30S ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5 ; ribosomal protein S5 domain protein; SPTR:
FT                   Q089N7 30S ribosomal protein S5; TIGRFAM: ribosomal protein
FT                   S5; PFAM: Ribosomal protein S5, N-terminal domain;
FT                   Ribosomal protein S5, C-terminal domain; TIGRFAM: ribosomal
FT                   protein S5, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74500"
FT                   /db_xref="GOA:E1SLV1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1SLV1"
FT                   /protein_id="ADN74500.1"
FT                   /translation="MANIENQAGDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMYTVSLKNGTLHHPVKGRHSGSKVYMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINIVRSTVDALVNMKSPEQIAAKRGLPVDE
FT                   IRG"
     atggcgaata ttgaaaatca agccggtgac ctgcaagaga agctcattgc agtaaaccgt        60
     gtttctaagg tggttaaagg tggtcgcatc tttagcttca ccgctctgac cgtagttggt       120
     gacggtaacg gccgtgttgg ctttggttac ggtaaggctc gcgaagtgcc tgccgctatc       180
     cagaaagcca tggaaaaagc ccgtcgcaac atgtacaccg tgtccctgaa gaacggcacc       240
     ctgcaccacc cggtgaaagg ccgtcactct ggttctaagg tttacatgca gcctgcttct       300
     gaaggtaccg gtattattgc tggtggtgcg atgcgcgccg ttctggaagt tgctggtgta       360
     cacaacgtac tggcgaaagc ttacggttcc accaacccga tcaacatcgt gcgctccact       420
     gttgacgcgc tggtgaacat gaagtctccc gagcaaatcg ctgctaagcg cggtctgccg       480
     gttgatgaga tccgggggta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page