(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE289

CP002209.PE289       Location/Qualifiers
FT   CDS_pept        318052..319371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0289"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="COGs: COG0201 Preprotein translocase subunit SecY;
FT                   InterPro IPR002208; KEGG: saz:Sama_0233 preprotein
FT                   translocase subunit SecY; PFAM: SecY protein; SPTR: A1XWX1
FT                   Preprotein translocase secY subunit; TIGRFAM: preprotein
FT                   translocase, SecY subunit; PFAM: eubacterial secY protein;
FT                   TIGRFAM: preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74503"
FT                   /db_xref="GOA:E1SME8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E1SME8"
FT                   /protein_id="ADN74503.1"
FT                   /translation="MAKPGLELKSAKGGLSELKARLWFVLGAIIVFRAGSFVPIPGIDA
FT                   AVLAELFKQQQGTIVSMFNMFSGGALERASIFALGIMPYISASIIMQLLTVVHPAMAEL
FT                   KKEGESGRRKINQYTRWGTLVLATFQSIGIATGLPSMLPGLVVNPGFGFYFVAVVSLVT
FT                   GTMFLMWLGEQITERGIGNGISILIFSGIVAGLPSAIGQTAEQARQGEMHLILLLGLVV
FT                   IVSLITAFVVFMERGQRRIVVNYAKRQQGRRVFAAQSTHLPLKVNMAGVIPPIFASSII
FT                   LFPGTLAQWFDKNQGGILSDISLALSPGQPLYVMIYAVAIVFFCFFYTALVFNPRETAD
FT                   NLKKSGAFIPGIRPGEQTARYIDKVMTRLTLAGAAYITFICLVPEFMMITTNVPFYFGG
FT                   TSLLIMVVVIMDFMAQVQTHLMSSQYESVLKKANLKGYGR"
     atggctaagc caggacttga gttaaaaagt gcgaaagggg gcctttcgga gttgaaagcg        60
     cgtctgtggt ttgtactcgg cgcgattatc gtattccggg caggttcttt cgtgccaatt       120
     cctggtattg acgccgctgt gcttgccgaa ctgttcaagc agcaacaagg taccatcgtg       180
     agcatgttca acatgttctc cggtggtgcc ttggaacgtg cctccatctt cgccctgggg       240
     atcatgccgt acatttcggc gtcgatcatc atgcagctac tgaccgtagt gcatcccgcc       300
     atggcggagc tgaagaaaga gggtgagtct ggtcgtcgta agatcaacca gtacacccgc       360
     tggggcaccc tggtactggc caccttccag tccatcggta ttgcaactgg cttgcccagc       420
     atgctgccgg gtctggtggt gaacccgggc tttggcttct actttgtagc ggtcgtgagc       480
     ctggtaactg gtaccatgtt cctgatgtgg ctgggtgagc agatcaccga gcgcggtatt       540
     ggtaacggca tctcgatcct gattttctca ggcatcgtgg ccggtctgcc ttccgctatc       600
     ggtcaaacgg cagagcaagc gcgtcaaggt gaaatgcact taatcctgct gctcggtctg       660
     gttgtgatcg tcagcctgat taccgctttt gtggtgttta tggagcgcgg tcagcgtcga       720
     atcgtggtaa actacgccaa gcgtcagcaa ggccgccgcg tattcgctgc tcaaagcact       780
     catttgcctc tgaaagtgaa tatggctggt gtgatcccgc cgatcttcgc gtccagcatc       840
     attctgttcc cgggcacttt ggcccaatgg ttcgataaga accagggtgg cattctgtca       900
     gacatctctc tggcactgtc tcccggacag ccgctgtacg tcatgattta tgcggtcgcg       960
     attgtcttct tctgtttctt ctacacggct ctggtgttca acccccgtga gactgcagac      1020
     aacctgaaga agagtggtgc gttcatcccc ggaattcgtc cgggcgagca aactgcccgt      1080
     tatattgata aagtaatgac ccgcctgact ctggctggcg cggcttacat tacctttatc      1140
     tgcttggttc cggagttcat gatgattacg accaatgtac ctttctactt tggtggtacc      1200
     tcactgctga ttatggtggt ggtaatcatg gacttcatgg ctcaggtaca gactcatctg      1260
     atgtcatctc agtatgaatc tgtgctgaag aaggccaacc ttaagggcta cggccgttaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page