(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE293

CP002209.PE293       Location/Qualifiers
FT   CDS_pept        320437..321057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0293"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="COGs: COG0522 Ribosomal protein S4 and related
FT                   protein; InterPro IPR001912: IPR002942: IPR018079:
FT                   IPR005709; KEGG: aha:AHA_0332 ribosomal protein S4; PFAM:
FT                   ribosomal protein S4; RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; SPTR: A0KF44 30S ribosomal
FT                   protein S4; TIGRFAM: ribosomal protein S4; PFAM: Ribosomal
FT                   protein S4/S9 N-terminal domain; S4 domain; TIGRFAM:
FT                   ribosomal protein S4, bacterial/organelle type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74507"
FT                   /db_xref="GOA:E1SMF2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF2"
FT                   /protein_id="ADN74507.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTVPGQHGARR
FT                   ARLSDYGVQLREKQKVRRMYGVLEKQFRNYYKEAARLKGNTGENLLQLLESRLDNVVYR
FT                   MGFGATRAEARQLVSHKAIKVNGRVVNIPSFSVSPNDVIAVREKAQKQARIKGALEVAE
FT                   QREKPTWVEVDGAKMEGTFKRLPERSDLSADINEQLIVELYSK"
     atggcaagat atttgggtcc taagctcaaa ctcagccgtc gtgaaggtac tgacctgttc        60
     ctgaaaagcg gcgttcgagc gatcgattct aaatgtaaga ttgataccgt acctggtcag       120
     cacggcgctc gtcgcgctcg tctgtccgac tacggtgttc agttgcgtga gaagcagaaa       180
     gtacgtcgta tgtacggcgt tctggaaaag caattccgta actactacaa agaagcggct       240
     cgtctgaagg gcaacactgg tgaaaacctg ctgcaactgc tcgaaagccg tctggacaac       300
     gtggtatacc gcatgggttt tggtgctacc cgcgccgaag ctcgtcagct ggtaagccac       360
     aaggccatca aggttaacgg tcgtgttgta aacatcccgt ccttctccgt ttctccgaac       420
     gacgttatcg ccgttcgcga gaaagctcag aagcaggccc gtattaaagg tgccctggaa       480
     gtcgctgagc aacgcgagaa gccgacttgg gtagaagtag acggcgctaa aatggaaggc       540
     actttcaagc gcctgccgga gcgtagcgat ctgtctgctg atatcaacga acagctgatc       600
     gtcgagcttt actccaagta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page