(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE298

CP002209.PE298       Location/Qualifiers
FT   CDS_pept        complement(323786..324538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0298"
FT                   /product="heme exporter protein CcmC"
FT                   /note="COGs: COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR003557: IPR002541; KEGG: shw:Sputw3181_0186 heme
FT                   exporter protein CcmC; PFAM: cytochrome c assembly protein;
FT                   SPTR: A1XWY1 Cytochrome c biogenesis protein CcmC; TIGRFAM:
FT                   heme exporter protein CcmC; PFAM: Cytochrome C assembly
FT                   protein; TIGRFAM: heme exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74512"
FT                   /db_xref="GOA:E1SMF7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF7"
FT                   /protein_id="ADN74512.1"
FT                   /translation="MWKWLHPYAHPERAYHLAGAMLPWFAALATLLIATGTIWGLGFAP
FT                   VDYQQGDSYRIIFLHVPAASMSMAAYTAMAICAFIGLVWQLKLADIAAAAIAPVGAVLT
FT                   FIALLTGAAWGKPMWGTWWVWDARLTSELVLLFLYLGVIALYASFEDKVMAAKAAGILA
FT                   IVGVINLPIIKYSVEWWNTLHQPNAITVGQSNNMPPEMLIPLLCNIFGFAVLIGALSIL
FT                   RFRAEVLARNSMRPWVRAMVEAEEKKSA"
     atgtggaagt ggttacaccc ctacgcgcac cctgagcgcg catatcacct ggccggagcc        60
     atgctgccct ggtttgcggc tttggctacc ctgcttatcg ccaccggcac catctggggc       120
     ttaggtttcg cccctgtcga ttatcagcaa ggtgattcct atcgcatcat cttcctgcac       180
     gtgcccgccg cctccatgtc gatggccgct tacaccgcca tggccatctg cgcctttatt       240
     ggcctggtct ggcagctgaa actggcggac atcgccgcag cggctatcgc accggtgggc       300
     gccgtactga cctttatcgc actgctgacc ggcgctgcct ggggcaagcc gatgtggggc       360
     acctggtggg tgtgggatgc acgactgacc tccgagttgg tgctgctgtt cctgtacctg       420
     ggcgttatcg ctctgtacgc ctccttcgag gacaaagtga tggccgccaa ggccgccggc       480
     atcctcgcca tcgttggcgt catcaacctg ccgatcatca agtactccgt agagtggtgg       540
     aacaccctgc accagcccaa cgccatcacc gtcggccaga gcaacaacat gccgcctgag       600
     atgctgatcc cgctgctgtg caacatcttt ggctttgccg tactgattgg tgccctgtcc       660
     attctgcgct tccgtgctga agtgctggcc cgcaacagca tgcgcccctg ggtgcgtgcc       720
     atggttgaag ccgaggagaa gaaaagcgca tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page