(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE299

CP002209.PE299       Location/Qualifiers
FT   CDS_pept        complement(324540..325223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0299"
FT                   /product="heme exporter protein CcmB"
FT                   /note="COGs: COG2386 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR003544; KEGG: swd:Swoo_4660 heme exporter protein CcmB;
FT                   PFAM: cytochrome c-type biogenesis protein CcmB; SPTR:
FT                   A1XWY2 Cytochrome c biogenesis protein CcmB; TIGRFAM: heme
FT                   exporter protein CcmB; PFAM: CcmB protein; TIGRFAM: heme
FT                   exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74513"
FT                   /db_xref="GOA:E1SMF8"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF8"
FT                   /protein_id="ADN74513.1"
FT                   /translation="MRQINYRQAFTTVLKRDLQIAFRHSGDIFNPLMFFVMVVTLFPLG
FT                   IGPEPNTLTRIAPGIIWVAALLSAMLSLERLFKSDYSDGALEQMMLSPQPLALMVLAKV
FT                   LAHWLVTGVPLILAAPLLAVLLHLDENSYGALMATLAVGTPILSLLGAIGVALTVGLRK
FT                   GGVLLSLLILPLYIPVLIFATSAIDAASMNMPFTGHLAILAAMLVGSLVLAPVAIGASL
FT                   RVSTN"
     atgcgtcaga ttaactatcg ccaagcgttc accacggtac tgaagcggga ccttcagatc        60
     gcgttccgcc acagcggtga tatcttcaac ccgttgatgt tcttcgtcat ggtggtcacc       120
     ctgtttccgc tgggtattgg ccctgagcca aacaccctga cccgaatcgc gcccggcatc       180
     atctgggtgg ccgcgttgct gtccgccatg ctgtcgctgg agcgcctgtt caaatccgac       240
     tacagcgacg gtgcgctgga gcagatgatg ctcagccccc agccgttagc gctcatggtg       300
     ctggccaaag tactggccca ctggctggtg actggcgtgc cgctgatcct ggccgccccg       360
     ctgctcgcgg tactgctgca cctggatgaa aacagctacg gtgctctgat ggccactctg       420
     gccgtcggca ctcccatctt gtccctgctg ggggcaatcg gcgtcgccct gaccgtaggg       480
     cttcgcaaag gcggtgtttt gctcagcctg ctgatcctgc cgctgtacat tcccgttttg       540
     attttcgcga ccagcgccat tgatgctgcg tccatgaaca tgccctttac tggccatctg       600
     gccattctcg cggctatgtt agtgggctct ctggttctgg cacccgttgc catcggcgca       660
     tccctaagag tgagtacaaa ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page