(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE300

CP002209.PE300       Location/Qualifiers
FT   CDS_pept        complement(325235..325882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0300"
FT                   /product="heme exporter protein CcmA"
FT                   /EC_number="3.6.3.41"
FT                   /note="COGs: COG4133 ABC-type transport system involved in
FT                   cytochrome c biogenesis ATPase component; InterPro
FT                   IPR003439: IPR003593: IPR005895; KEGG: sbp:Sbal223_4024
FT                   heme exporter protein CcmA; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: Q0HNQ5 Cytochrome c biogenesis
FT                   ATP-binding export protein ccmA; TIGRFAM: heme exporter
FT                   protein CcmA; PFAM: ABC transporter; TIGRFAM: heme ABC
FT                   exporter, ATP-binding protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74514"
FT                   /db_xref="GOA:E1SMF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMF9"
FT                   /protein_id="ADN74514.1"
FT                   /translation="MTEASRTPLLTAQALTCIREERILFDELSFDIHPGDIIQIEGPNG
FT                   AGKSSLLRILAGLSRPYAGQVHYCGERIEDVRDDYHADLLFLGHLPGVKGELTAEENLE
FT                   FNLKIAGYADAPIHDTLAKVNLTGFEEHPAGHLSAGQHRRIALARLWHTQSKIWILDEP
FT                   LTAIDKRGVQELEQLFMQHADNGGCVILTTHQDLQLVSGDRLRKLRLDYQFV"
     gtgacagaag catcccgcac accgctgttg actgcccagg cgctgacctg catccgtgaa        60
     gaacggatcc tgttcgacga actgagcttt gatattcacc ctggtgacat catccagatc       120
     gaaggaccca acggcgccgg aaagagcagc ctgttgcgca tcctcgccgg tctgtcccgt       180
     ccctacgccg gccaggtgca ttactgtggc gagcgtatcg aggacgtccg tgatgactat       240
     cacgccgact tgctgttcct cggccacctg cctggcgtta aaggcgaact caccgccgaa       300
     gagaacctcg agttcaacct caagattgcc ggctacgccg atgctcccat ccacgacacc       360
     ctggccaagg tcaatctgac cggctttgaa gagcacccgg ccggccacct gtccgcgggt       420
     cagcatcgtc gtatcgccct cgcccgcctc tggcacactc aatccaaaat ctggatcctc       480
     gatgagccgt taaccgccat cgacaaacga ggcgtgcagg agctggagca actgtttatg       540
     caacacgccg ataatggcgg gtgcgtgatc ctcaccactc accaggatct gcagctggtt       600
     tctggcgacc gtctgcgcaa gcttcggctt gactaccaat ttgtttag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page