(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE304

CP002209.PE304       Location/Qualifiers
FT   CDS_pept        330214..330768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0304"
FT                   /product="periplasmic protein thiol/disulfide
FT                   oxidoreductase DsbE"
FT                   /note="InterPro IPR006662: IPR000866: IPR013740: IPR017937:
FT                   IPR 004799; KEGG: swp:swp_2047 thiol:disulfide interchange
FT                   protein DsbE; PFAM: Redoxin domain protein; alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; SPTR: A2UXA5 Periplasmic protein
FT                   thiol--disulphide oxidoreductase DsbE; TIGRFAM: periplasmic
FT                   protein thiol/disulphide oxidoreductase DsbE; PFAM:
FT                   Redoxin; TIGRFAM: periplasmic protein thiol:disulfide
FT                   oxidoreductases, DsbE subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74518"
FT                   /db_xref="GOA:E1SMG3"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMG3"
FT                   /protein_id="ADN74518.1"
FT                   /translation="MKRAALFVPLFIFLGLSVFLFKGLFLDPSKLDSVLVGNPVPTFEL
FT                   ETLEDAGVKITNEDLLGDVYLINVWATWCPSCKYEHPFLNQLQRQGAIKIYGVNYRDER
FT                   DLAIRYLAQSGDPYTRNIFDPEGTLSFDMGVYGAPETFVVDHNGIVRHRFAGVLEPQVW
FT                   AKDFMPLIQQIRAEAAAEGNS"
     atgaaacgcg cagcactctt tgtaccgctg ttcatctttc tgggattgag tgtgttcctg        60
     tttaaggggt tgttccttga cccctctaaa ctggattccg tgctggtggg caacccggtg       120
     cccacctttg aactggaaac actggaagac gcgggcgtta agatcaccaa cgaggatctg       180
     ttgggcgacg tgtacctcat caacgtgtgg gccacctggt gtccctcctg taagtatgag       240
     cacccgttcc tgaaccaact ccagcgccag ggcgccatta agatctacgg cgtcaactac       300
     cgtgacgagc gtgatctggc gatccgctat ctggcgcaga gtggtgatcc ttacactcgc       360
     aacatcttcg acccggaagg cactctctct tttgatatgg gtgtgtacgg cgcgccggag       420
     acctttgtgg tagaccacaa cggcatcgtg cgtcaccgct ttgccggtgt gcttgagccg       480
     caggtgtggg ccaaggactt tatgccgctg atccagcaga tccgtgctga agcggcagca       540
     gaggggaact cctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page