(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE316

CP002209.PE316       Location/Qualifiers
FT   CDS_pept        351144..352223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0316"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="COGs: COG4972 Tfp pilus assembly protein ATPase
FT                   PilM; InterPro IPR005883; KEGG: sbn:Sbal195_4207 type IV
FT                   pilus assembly protein PilM; SPTR: A2V3F8 Type IV pilus
FT                   assembly protein PilM; TIGRFAM: type IV pilus assembly
FT                   protein PilM; PFAM: Competence protein A; Cell division
FT                   protein FtsA; TIGRFAM: type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74530"
FT                   /db_xref="GOA:E1SMH5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH5"
FT                   /protein_id="ADN74530.1"
FT                   /translation="MLSKLFKPRLPRMVGVDIGSREVKAILLAETPDGYQVDGVGKVPL
FT                   PRGAVVDREIKDPVAVGTAMAQLRAQLPKDVKFGAASVSGSTVMTKVIQMDGSLSDEEL
FT                   EAQIEIEADNLIPYPLEEVNIDFQTLNINDNDAGKVDVLLAACRSDNVDSRVDALDSAE
FT                   LDAKVIDIEGYALGRSAKLVAKQVPGGLTGQVVALVDLGASMTTFSIVDNGETVFIREQ
FT                   AFGGEQFTQSILSYYGMSYDEAEAAKVNNELPRNYVFEVLAPFQTQLLQQIRRTLQIYC
FT                   NASGKEKVDCLILSGGSAAIEGLTTLLSNELSIPVEIANPFTGSVTVKESLRRQLESDF
FT                   PRYMVACGLALRSFEPWHT"
     atgctttcca aattgttcaa accccgttta cctcggatgg tgggggtgga catcggttct        60
     cgtgaagtca aagcgatctt actggctgaa actcccgatg gctaccaggt tgatggcgtc       120
     ggcaaagtgc cgcttccccg tggcgcggtt gtcgatcgtg aaattaagga ccccgttgcg       180
     gtgggcaccg ctatggctca gttgcgagcc cagttgccca aggacgttaa gttcggtgcg       240
     gcgtcggtgt ccggctcgac ggtcatgacc aaggtcatcc agatggatgg cagcctgagt       300
     gatgaagagc tcgaagccca gattgagatc gaagcggata acctgatccc ctacccgcta       360
     gaagaggtca acattgactt ccaaaccctg aatatcaatg acaatgacgc tggcaaggtg       420
     gatgtcctgc tggcggcttg tcgctcggat aacgtcgatt cgcgggtgga cgcgctcgat       480
     tccgctgagc tggatgccaa ggtgatcgac attgaggggt atgccctggg ccgcagcgcc       540
     aagctggtgg ccaagcaggt acccggaggc ctgaccggtc aggtggtggc gttggtcgat       600
     ctcggcgcca gcatgaccac cttctccatc gtcgataacg gtgaaacggt gtttatccgt       660
     gaacaggcgt ttggcggtga gcagttcact cagtccattc tctcctacta cggcatgagc       720
     tacgacgaag ccgaggcggc caaggtcaac aatgaactgc cccgcaacta cgtgtttgaa       780
     gtgttggcgc cgtttcagac ccagctgctg caacagatcc gccgtaccct ccagatctac       840
     tgcaatgcct ccggcaaaga gaaggtcgat tgcctgatcc tcagtggcgg cagtgcagcc       900
     attgaagggc tgaccactct gctcagcaac gagttgagca taccggtgga gatcgccaac       960
     ccctttaccg gttcggtgac ggtcaaggaa agcctgcgtc gccagcttga gagcgacttc      1020
     cctcgctata tggtggcctg cggcctggcg ttaaggagct ttgaaccatg gcacacataa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page