(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE318

CP002209.PE318       Location/Qualifiers
FT   CDS_pept        352813..353415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0318"
FT                   /product="Pilus assembly protein PilO"
FT                   /note="COGs: COG3167 Tfp pilus assembly protein PilO;
FT                   InterPro IPR007445; KEGG: shn:Shewana3_3897 pilus assembly
FT                   protein, PilO; PFAM: Pilus assembly protein PilO; SPTR:
FT                   A2V3F6 Pilus assembly protein, PilO; PFAM: Pilus assembly
FT                   protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74532"
FT                   /db_xref="GOA:E1SMH7"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH7"
FT                   /protein_id="ADN74532.1"
FT                   /translation="MKVDLKQLNDLDFENLANWPKEVKIIFAVVLAVLVGVAGYFLFIK
FT                   DSMASLERLQAEEQKLRGEFEAKYRLAANLPRYREQLTQMTEQFEAMLGMLPTASEMPG
FT                   LLDDVTFLATDANLQINSLNWQPEQVKEFYVELPIEMKIQGGYHEFGAFSAGVANLPRI
FT                   VSLHDFTMERAANGVSMTVLAKTYRFAEMADPEGGKK"
     atgaaggtcg acctgaaaca gctgaatgac ctcgacttcg agaatctggc gaactggcct        60
     aaagaggtca aaatcatctt tgccgtggtg ctggccgtat tggtgggcgt ggcaggttac       120
     ttcctcttta tcaaggactc gatggccagc ctggagcgtc tgcaggcgga agagcagaag       180
     ctgcggggcg aatttgaggc caagtatcgg ctggcggcga atttaccgcg ataccgtgag       240
     caactgacgc agatgaccga gcagtttgaa gcgatgctcg gtatgttgcc caccgccagt       300
     gaaatgcccg gtttgctgga tgatgttacc ttcctggcga ccgacgccaa cctgcagatc       360
     aatagcctta actggcagcc ggagcaggtc aaagagtttt acgtggaact gcctatcgag       420
     atgaagatcc agggggggta tcacgagttt ggtgcgtttt ctgctggtgt cgccaacctg       480
     cccaggatcg tcagcttgca tgatttcacc atggagcggg ccgcgaatgg cgtcagtatg       540
     acggtactgg ctaagaccta tcgctttgcg gagatggcgg atcctgaggg gggcaagaag       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page