(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE319

CP002209.PE319       Location/Qualifiers
FT   CDS_pept        353415..353930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0319"
FT                   /product="Pilus assembly protein PilP"
FT                   /note="COGs: COG3168 Tfp pilus assembly protein PilP;
FT                   InterPro IPR007446; KEGG: saz:Sama_3370 type IV pilus
FT                   biogenesis protein PilP; PFAM: Pilus assembly protein PilP;
FT                   SPTR: A2V3F5 Pilus assembly protein, PilQ; PFAM: Pilus
FT                   assembly protein, PilP"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74533"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH8"
FT                   /protein_id="ADN74533.1"
FT                   /translation="MRKVSLAALLLLTGCGGGMGDLREFVADVQSTPVPFNEPPVTPPE
FT                   FKSVPYQVAQLRSPFQQSARSITDPVDLGRPDCPQPDNQRKRATLEAFALDSLDLKGLM
FT                   QDPSHYWALLQAGDGNVYTVKEGDYLGLYHGQIADINDDGVLVTEWIPDGNGCWNQRDT
FT                   RMVLARDE"
     atgcgaaaag tcagtcttgc tgcgctgctg ctgttgaccg gctgtggcgg tggcatgggc        60
     gatttgcggg agtttgtggc ggatgtgcag agcacgcctg tgcccttcaa cgagcccccg       120
     gtaacgccac cggagtttaa gtcagtgcca taccaggtgg cccagctgcg tagcccgttt       180
     cagcaatctg cgcgcagtat caccgacccg gttgatctgg gacgccccga ctgcccgcaa       240
     ccggataatc agagaaagcg cgccacctta gaagcgtttg cgctcgacag tttggactta       300
     aaaggtctga tgcaggatcc aagccattat tgggctctgc tgcaggccgg tgacggtaat       360
     gtctataccg tcaaagaggg tgactacctg ggcctgtatc acggccagat cgccgacatc       420
     aatgatgacg gtgtgctagt gaccgagtgg atccccgacg gcaatggctg ttggaatcag       480
     cgcgacacca gaatggtttt ggccagggat gaataa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page