(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE320

CP002209.PE320       Location/Qualifiers
FT   CDS_pept        353943..355988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0320"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="COGs: COG4796 Type II secretory pathway component
FT                   HofQ; InterPro IPR001775: IPR004846: IPR011662: IPR005644:
FT                   IPR 018252: IPR004845: IPR013355; KEGG: shw:Sputw3181_3848
FT                   type IV pilus secretin PilQ; PFAM: type II and III
FT                   secretion system protein; Secretin/TonB short domain; NolW
FT                   domain protein; SPTR: A2V3F4 Type IV pilus secretin PilQ;
FT                   TIGRFAM: type IV pilus secretin PilQ; PFAM: Bacterial type
FT                   II/III secretion system short domain; Secretin and TonB N
FT                   terminus short domain; Bacterial type II and III secretion
FT                   system protein; TIGRFAM: type IV pilus secretin (or
FT                   competence protein) PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74534"
FT                   /db_xref="GOA:E1SMH9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMH9"
FT                   /protein_id="ADN74534.1"
FT                   /translation="MSFFSGIRQGLPRLQHRIIASRLLLGGVLLCLANSATAGTLQDLR
FT                   YQAQVDDMLEVELAFDQLAGEPRIAVSANPAELTLHFAGSQSGLQMSQIPIDLKGIKAV
FT                   ETRSGSNGLDVVFQLEKMTTYQGRLDGNRYRITFNDNSPVARAETPQFLNEIESINFHR
FT                   GDNGQAQLVLSLSSPTAAANFNRVGSDLELTLYNTRIQDKDLYIVDVQDFSTVVTGFET
FT                   FRDNANARLRFDVRGEFVFDSRQEGNRLVIDIAEQTQPLMEEKVYDGSTLSMNFQDVPV
FT                   RTVLQIIADHNQFNLVTTENVAGNLTLHLDKVPWDQALDMILKIRGLDKRIEGNILLVA
FT                   PRDELAAQESLELRAAQEVREVAPLFSEYLQINYAKAVDIATLLDNDGNTLLSERGSVS
FT                   VDERTNTLLVYDTAERLEDIHRLVDILDVPVKQVVIESRMVTVRDNINEELGIRWGISD
FT                   QQGDKGTAGTLPGAEDIANGIVPSLSDRLNVNLPVVEPAGSIAFHVAKLGDGTLLDLEL
FT                   SALERENKGEIIASPRLTTANQYTAFIEQGTEIPFVQSTSSGATSVEFKKAVLGLTVTP
FT                   QITPDNRIVLDLTVTQDTRGETVQTATGPAVAIDTQRISTQVLAQNGETIVLGGIFQQQ
FT                   QLNTVTKVPLLGDIPFVGVLFRNSQDFTEKKELLIFVTPKIVIDEF"
     atgagtttct tttcagggat tcggcaggga ctgccgcgat tacaacatcg catcatcgcc        60
     agtcgtctgt tgctcggcgg tgttttgctt tgtttggcca atagcgcaac ggccgggacg       120
     ctgcaggatc tgcgctatca ggcacaggtg gatgacatgc tcgaggttga actggcgttt       180
     gaccagttgg ctggcgagcc ccgaattgcc gtctccgcca acccggcgga gttaaccctg       240
     catttcgccg gcagtcagtc cggcctgcag atgagccaaa tcccgattga tcttaagggg       300
     attaaggcgg ttgagacgcg ctccggcagc aacggtttgg atgtggtgtt ccaactggag       360
     aagatgacca cctaccaggg gcgtctggat ggtaatcgct accgcattac tttcaatgac       420
     aacagcccgg tagcccgcgc cgaaacgccg cagttcctca acgagattga gagcattaac       480
     ttccaccgcg gagataacgg tcaggcgcaa ttggtactga gtctgagcag ccccacggcg       540
     gccgccaact tcaatcgagt gggtagcgat ctggaactga cgctctacaa cacccggatc       600
     caggataagg atctgtacat cgttgatgtg caggacttca gcaccgtggt cacaggcttt       660
     gaaaccttcc gtgataacgc caatgcccgt ttgcgctttg acgtgcgggg ggagttcgtc       720
     ttcgacagcc gtcaggaggg caaccgcctg gtgatcgaca ttgccgagca gactcagccc       780
     ctgatggaag agaaggtcta cgacggcagc accctgtcga tgaacttcca ggatgtgccg       840
     gtgcggacgg tgcttcagat cattgccgat cacaatcaat ttaacctggt gaccaccgaa       900
     aacgtggcag gcaacctgac cctgcatctg gacaaggtgc cttgggacca ggcgctggat       960
     atgatcctta aaatccgcgg tctggataag cgcatcgaag gcaatatcct gctggtggcg      1020
     ccccgtgatg agctggcggc ccaggagagc ctggagctgc gtgccgccca ggaggttcgc      1080
     gaggtcgcgc cgttgttctc agagtatctg cagatcaact acgccaaggc ggtcgacatc      1140
     gccaccctgc tggataacga cggcaatacc ctgttgtccg agcgaggctc cgtgtcggtg      1200
     gatgagcgta ccaacaccct gctggtgtat gacacggcgg aacgactgga agacattcac      1260
     cgactggtgg atatcctcga cgtgccggta aaacaggtgg tgattgagtc gcggatggtg      1320
     accgtacgcg acaacatcaa cgaagaactg ggcatccgct ggggcatcag cgaccagcag      1380
     ggcgacaagg gcaccgccgg taccctgccg ggcgcagaag acatcgccaa cggcatcgtc      1440
     ccctctctga gtgaccgcct gaacgtgaat ctgccggtgg tagagccggc gggcagcatc      1500
     gccttccacg tagccaaact gggtgatggc actctgttgg atctggagct gtcggctctg      1560
     gagcgtgaga acaaaggcga aatcatcgcc agtccgcgac tgaccaccgc caaccagtac      1620
     accgccttta ttgagcaggg caccgagatc ccctttgtgc agtccacctc cagtggtgcg      1680
     acctcggtgg agtttaaaaa agcggtactg ggtctgaccg tgacgccgca gatcaccccg      1740
     gacaaccgca ttgttctcga tctgaccgtg actcaggaca cccggggtga aacggtccag      1800
     accgccaccg gccctgcggt ggccatcgat actcagcgca tttcgaccca ggtactggca      1860
     cagaatggcg agacgattgt gctcggtggc atcttccagc agcagcagtt gaacaccgtc      1920
     actaaggtgc cgttgttggg cgacattccc tttgttgggg tcctgttccg caacagccag      1980
     gatttcaccg agaagaaaga actgctgatt ttcgttaccc cgaaaatcgt tatcgacgag      2040
     ttttga                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page