(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE321

CP002209.PE321       Location/Qualifiers
FT   CDS_pept        356149..356664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0321"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="COGs: COG0703 Shikimate kinase; InterPro IPR000623;
FT                   KEGG: shl:Shal_4082 shikimate kinase I; PFAM: shikimate
FT                   kinase; PRIAM: Shikimate kinase; SPTR: B0TL77 Shikimate
FT                   kinase; PFAM: Shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74535"
FT                   /db_xref="GOA:E1SMI0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI0"
FT                   /protein_id="ADN74535.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLEFFDSDQEIEARSGA
FT                   DISWIFDVEGEEGFRNREARVIHELTEKQGIVLATGGGSVQSKEVRNRLSARGIVVYLE
FT                   TTIDKQVARTQRDKRRPLLQVDEPRDVLEQLAEERNPLYQEIADLVVRTDEQSAKVVAN
FT                   QIIEKLGF"
     atggctgaaa aaagaaatat atttctcgta ggtcccatgg gcgctggtaa aagcaccatt        60
     ggtagacacc ttgctcaaat gctccacctg gagtttttcg actccgatca ggagatcgaa       120
     gcccgtagcg gcgcggatat ctcctggatc tttgatgttg agggtgaaga ggggttccgc       180
     aaccgtgaag ctcgggtgat ccatgaattg accgagaagc agggcattgt gctggccacc       240
     ggtggtggtt ctgttcagtc aaaagaggtt cgtaaccgtt tgtctgcccg cggcattgtg       300
     gtgtatctgg aaaccaccat cgataagcag gttgctcgta cccagcgcga taagcgtcgc       360
     ccgctgctgc aggttgacga gccgcgcgat gtgctggagc aactggctga agagcgcaac       420
     ccgctgtacc aagagatcgc ggatctggtc gtacgtaccg acgaacagag cgccaaagtg       480
     gttgccaacc agatcatcga gaaactcggt ttctaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page