(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE323

CP002209.PE323       Location/Qualifiers
FT   CDS_pept        357765..359228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0323"
FT                   /product="Sporulation domain protein"
FT                   /note="COGs: COG3266 conserved hypothetical protein;
FT                   InterPro IPR007730; KEGG: she:Shewmr4_3696 sporulation
FT                   domain-containing protein; PFAM: Sporulation domain
FT                   protein; SPTR: A2V3F1 Sporulation related"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74537"
FT                   /db_xref="GOA:E1SMI2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI2"
FT                   /protein_id="ADN74537.1"
FT                   /translation="MIADPALNHLLPSQRALLERFRYLTEYGDHLLVLHGAAGVGKTVL
FT                   AQSLLDGAESFNQAYVAIGDDLTPASVRERLIRQWLPRAVFDPEEPLLDTLERILPEGD
FT                   GRYMLIVDDAQSMGDALLAELIALVMDQETLGMRLTLVLVADDGLVQRLQQNLPEPYQT
FT                   RLIPVEVPPLSVRERRKLYDQLVKRHSGKLFINQAAVERQLAEQDGSAAAVVALVEAAK
FT                   SRPPLGQSLPAHKGLAAAIGAAVLLLAGGLLWPTTEPAPQPEPLAQADRAAAPEPEPEQ
FT                   QAPQPLDLGLAKPWPEVTTAEVAIPEVEPALLLPEDEIAVATAPVVSAETESVAQAQPA
FT                   ETATAAVAQPAAQPMAQPAPDSEAKPEPSVEPAVAAVPAVLPLSEQPLAQRPADSYVLQ
FT                   LAVFSYPQLIGPFLDSHGLGEAVRVYRIEREPQAWFVVVQGGFADRKAAQQAKEALVAS
FT                   VKRLSPYVKPLEAVQKELSEELELAEILR"
     atgatcgcgg atcctgcctt aaaccacctg ctgcccagcc agcgcgcgct gcttgagcgc        60
     tttcgttacc tgactgaata cggtgatcac ctgctggtgc tgcatggcgc tgccggggtg       120
     ggcaagaccg tgctggctca gtcactgctg gacggtgcgg aatcgttcaa ccaggcctat       180
     gtggccatcg gggatgacct gactccggcc agtgtgcgcg aacgactgat tcgacagtgg       240
     ctgccccggg cggtgtttga cccggaagaa cccttactcg atacccttga gcggatcctg       300
     ccggaaggcg acggtcggta tatgctgatc gtcgacgacg cccagagcat gggtgatgcc       360
     ctgctggcgg aactgattgc cctggtgatg gaccaggaaa cactggggat gcgattgacc       420
     ctggtgctgg tggcggatga tggcctggtg cagcgcctgc agcagaacct acctgagcct       480
     taccagaccc gcctgatccc ggtggaggtt ccccctctgt cggtgcgcga gcgccgtaag       540
     ctgtacgacc aactggttaa gcgccactcc ggcaaactgt ttatcaatca ggctgctgtc       600
     gagcggcaac ttgctgagca ggacggcagc gccgctgcgg ttgtcgccct ggtggaagcc       660
     gctaagtcca ggccgcctct ggggcagtcg ttgccggctc ataaggggct ggcagccgcc       720
     attggtgccg cggtattgct gctggcgggt gggttgttgt ggccgaccac cgagccggca       780
     ccgcagcctg aaccgctggc acaggcagac cgcgctgcag cgccagagcc agagccagag       840
     caacaagcgc cgcagccgct ggatcttggg ttggccaaac cctggccaga ggtgaccact       900
     gccgaagtgg ctatccccga ggtagagccc gctctgctgt tgccggaaga tgagatcgct       960
     gtggcgacag ctccagtggt cagcgccgaa accgagagcg ttgcccaagc tcaaccggcg      1020
     gagacggcaa ccgcagcagt cgcgcaaccg gctgcccaac ccatggctca acctgcgcca      1080
     gacagtgaag cgaaaccgga gccgtcggtc gagcccgcag tggcagcggt gcccgccgta      1140
     ttgccgctgt cggagcagcc gctggcacag cgcccggcgg acagttatgt tctgcagttg      1200
     gcggtgtttt cttaccccca gctgatcggt ccgttcctgg acagccacgg cctcggtgaa      1260
     gcggtgcggg tttatcgcat tgaacgagag ccacaagcct ggtttgtggt ggtgcaggga      1320
     ggatttgccg acaggaaagc ggcacagcag gccaaggagg ccctggtggc gtcggttaaa      1380
     cgactgtccc cttacgtcaa accgctcgag gcagtgcaaa aagagctgtc cgaggaactg      1440
     gaactggctg agatcctccg ctaa                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page