(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE326

CP002209.PE326       Location/Qualifiers
FT   CDS_pept        complement(360252..360515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3843 hypothetical protein; SPTR:
FT                   A2V3E9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74540"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI5"
FT                   /protein_id="ADN74540.1"
FT                   /translation="MAKRKGLKRGVVILTGVLALAATGVTLHHHRCDDAQSVAQCAAQS
FT                   PLNWHNWLVGRSGSSQFHFVDLLELLYGHEKRPTSSPSGPLN"
     atggcaaaac ggaaaggtct gaagcggggc gtggttatcc tgaccggcgt tttagcgctg        60
     gcagcaaccg gcgttaccct gcaccatcat cgctgcgacg acgctcagtc tgtcgcccaa       120
     tgcgccgcgc aatcgccact gaactggcac aactggttag tgggccgcag tggttccagc       180
     caattccatt tcgttgacct gcttgaactg ctgtacgggc acgaaaaacg cccgacctct       240
     tcgccgagcg gtccgctgaa ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page