(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE327

CP002209.PE327       Location/Qualifiers
FT   CDS_pept        complement(360629..361294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR010239; KEGG: saz:Sama_3159 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A2UUU4
FT                   Putative uncharacterized protein; PFAM: Bacterial protein
FT                   of unknown function (Gcw_chp); TIGRFAM: conserved
FT                   hypothetical protein, proteobacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74541"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI6"
FT                   /protein_id="ADN74541.1"
FT                   /translation="MMKKFALSSLAIALMASSAAVSAVEFSGNVGATSDYLWRGLSQTD
FT                   GKPAVSGGLDMYTDAGFYAGTWASNIDFGDDATYEIDFYAGYYGEVGDFFYDVGYNYYA
FT                   YPNGEDLDFGEVYGSVGWNWLGLNVFYATNESASEDYYKDSFYVEGTAAFDLSDSLSLG
FT                   FAIGHQSFDIDDEDDYITYNVSLTKSTDLGDVAFMVSDTDLDDDDPIVLVSWTYEFDL"
     atgatgaaaa aatttgcact ctcctctctg gctatcgccc tgatggccag cagcgcagcg        60
     gtttctgccg ttgagttcag tggtaacgta ggcgcgacca gcgactacct gtggcgtggt       120
     ctgtctcaga ccgacggtaa gcctgcggta tccggtggtc tggatatgta caccgatgct       180
     ggcttctacg ccggtacctg ggcgtccaac atcgacttcg gcgacgacgc cacctatgag       240
     atcgatttct acgccggtta ctacggcgag gttggcgact tcttctacga tgtcggttac       300
     aactactacg cctaccccaa cggtgaagat ctggattttg gtgaagtcta cggcagcgta       360
     ggctggaact ggctgggcct gaacgtcttc tacgccacca acgaaagcgc cagcgaggac       420
     tactacaagg actcgttcta cgttgaaggt actgcggctt ttgacctgag tgacagcctg       480
     agcctgggct tcgccatcgg ccaccagagc ttcgacattg acgatgaaga cgactacatc       540
     acctacaacg tgtctctgac caagagcacc gatctgggtg acgttgcctt tatggtcagc       600
     gacaccgacc tggacgatga cgacccgatc gttctggtaa gctggaccta cgagttcgac       660
     ctgtaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page