(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE329

CP002209.PE329       Location/Qualifiers
FT   CDS_pept        362157..362858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0329"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="COGs: COG0546 phosphatase; InterPro IPR005833:
FT                   IPR005834: IPR006402: IPR006439: IPR 006388: IPR006346;
FT                   KEGG: shl:Shal_4075 phosphoglycolate phosphatase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; SPTR:
FT                   A2V3E7 Phosphoglycolate phosphatase; TIGRFAM:
FT                   phosphoglycolate phosphatase; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 2 (HAD-like); PFAM: haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 3 with third motif
FT                   having DD or ED; haloacid dehalogenase superfamily,
FT                   subfamily IA, variant 1 with third motif having Dx(3-4)D or
FT                   Dx(3-4)E; 2-phosphoglycolate phosphatase, prokaryotic;
FT                   2-haloalkanoic acid dehalogenase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74543"
FT                   /db_xref="GOA:E1SMI8"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMI8"
FT                   /protein_id="ADN74543.1"
FT                   /translation="MLSSEIRAIAFDLDGTLIDSVPALAEAAAAALVDLGMAPCSELAA
FT                   RGWIGNGAEMLMRRALSGNVNPDPNLAPSLVEQALARFHHHYGAHLDQGSPLYPGVADT
FT                   LAALHQRGYRMALITNKPARYLPDLMATCGLSHYFELMLGGDSLAQRKPDPMPLQHVLT
FT                   QFGLAPQQMVMVGDSRNDIEAARAAGCASVGLTYGYNYGQPIAELGPDHVLDHFEHLLA
FT                   LLPARQETESV"
     atgctgagct cagagatccg tgccatcgcg tttgacctcg atggcaccct gattgacagt        60
     gtgcccgcgc tggctgaagc ggcggctgcc gcactggtcg acctgggtat ggccccctgt       120
     tccgagctgg ccgctcgcgg gtggattgga aacggtgccg agatgttgat gcgtcgggcg       180
     ctaagcggta atgtgaaccc cgaccccaac ctggcgccct ccttagtgga gcaggcgctg       240
     gcgcgttttc atcatcatta tggcgcgcac ctggaccagg gcagcccgtt gtaccccggt       300
     gttgcggata ccctggcggc cctgcaccag cgcggctacc ggatggcgtt gatcaccaat       360
     aagccggcgc gctacctgcc tgacctgatg gccacctgtg gcctgagcca ttactttgag       420
     ctgatgctcg gtggtgactc cctggcccag cgcaagcccg accccatgcc gctgcagcat       480
     gtgctgaccc agttcggcct ggcgccgcag cagatggtga tggtgggcga ctcccgtaac       540
     gatatcgaag cggcccgtgc agcgggctgc gccagcgttg gcctgactta cggttacaac       600
     tacggtcagc ccatcgctga gctgggtccg gatcatgtac tggaccactt tgaacacctg       660
     ctggcgttgt tgccggctcg acaagagact gaatctgtat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page