(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE34

CP002209.PE34        Location/Qualifiers
FT   CDS_pept        37985..38260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0034"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="InterPro IPR009962; KEGG: vfi:VF_2534 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1488; SPTR:
FT                   P45795 Uncharacterized protein yrdB; PFAM: Protein of
FT                   unknown function (DUF1488)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74248"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV94"
FT                   /protein_id="ADN74248.1"
FT                   /translation="MNQQILFNDHVEIEWEQGWAKFHAMVAGQQVPCLVGLNVLANKLD
FT                   STLTSAEEAAAAFEQLRFDLEAEAEMLIEDEAYDAQGRIWLGHPPI"
     atgaatcagc agatcctctt taacgaccat gtcgaaattg agtgggagca gggctgggcg        60
     aagtttcacg ctatggtggc gggtcagcag gtgccctgcc tggtcgggct gaatgtactg       120
     gccaataaac tggacagcac attaaccagt gccgaagaag cggcggccgc gtttgaacag       180
     ctgcgctttg atctggaagc ggaggcggaa atgctgattg aagatgaagc gtatgatgca       240
     caagggcgga tctggctggg ccatccgccc atctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page