(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE340

CP002209.PE340       Location/Qualifiers
FT   CDS_pept        371913..373703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0340"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="COGs: COG0768 Cell division protein
FT                   FtsI/penicillin-binding protein 2; InterPro IPR001460:
FT                   IPR005311; KEGG: spl:Spea_3817 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase; Penicillin-binding protein dimerisation
FT                   domain; PRIAM: Peptidoglycan glycosyltransferase; SPTR:
FT                   A2UXQ4 Penicillin-binding protein, transpeptidase; PFAM:
FT                   Penicillin binding protein transpeptidase domain;
FT                   Penicillin-binding Protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74554"
FT                   /db_xref="GOA:E1SMJ9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMJ9"
FT                   /protein_id="ADN74554.1"
FT                   /translation="MTRRKINKPSNKSKQAKQKLKPTPFLWRLRLVTFAIALVFSGIVA
FT                   RAAYIQVIAPDRLRHESDLRTLRLETRDVQRGMITDRNGEMLAVSVPVQAVWADPKRVF
FT                   EGNGFDDPRRWRALADVLEVPEAELVERVKQDPKRRFLYLRRQVTPAVAEYIAKLRIPG
FT                   VGLKPESRRYYPAGEATGQLIGLTNIDDKGIEGLERNYDDWLTGSPEKVRVRKGLGGEV
FT                   VENLSVVAEGEHPNDLVLSLDMRLQSLAYRALKKATQYHMATSGSLVIIDIPTGEILAM
FT                   ANTPSFNPNQRSGIQAYQMRNRAITDAYEPGSVVKPLVVAAAMEKGLVTPDTVMDTSPG
FT                   WMRVSGGLVRDTRNFGKQDVTHLLVKSSNIGMAKMALQMEVDELLAFYADFGLGTYSGI
FT                   NLDGETTGNVPKRRRWSEHERATLAFGYGLTSTPLQLARMYAILGANGVARPASILKLR
FT                   DGQVPEGEQVLSPKVAKQMLAILTQVTEPGGTATRAAIDGYKVAGKTGTSRKAVAGGYG
FT                   EDYVSLFAGLAPSDNPRLAMAVVINEPQGDAYYGGVVAAPVFSEVMAGALQLLNVEPSQ
FT                   RSPELGTLASVWGSDNVVTR"
     atgacccgac gcaagatcaa taagcccagc aacaagagca aacaggccaa gcagaagctg        60
     aagccgacgc cgttcctgtg gcgtttgcgc ctggtgacct ttgccatcgc gctggtgttc       120
     agcggcatcg tggcccgggc ggcttacatc caggtgatcg cgccggatcg cctgcgtcac       180
     gaaagtgacc tgcgcaccct gcggctggaa acccgcgatg tgcagcgtgg catgatcacc       240
     gatcgtaacg gcgagatgct ggcggtcagt gtgccggtgc aggcggtgtg ggccgatccc       300
     aagcgggtgt ttgaaggcaa cggctttgac gatccgcgcc gctggcgtgc gttggcggac       360
     gtgctggaag tgccggaagc cgagttggtt gagcgggtta aacaggatcc caagcgccgc       420
     ttcctctacc tgcgtcgtca ggttaccccg gccgtggccg agtacatcgc caaactgcgc       480
     atccccggtg tgggcctcaa gccggagtca cgccgttatt accccgccgg tgaagccacc       540
     ggccagttga ttggcctgac caacatcgat gataagggca tcgaggggct ggagcgcaac       600
     tacgacgact ggctgaccgg ttcgccggag aaggtccggg tgcgtaaggg gttgggcggt       660
     gaagtggtgg aaaacctctc tgttgttgcc gaaggcgagc atccgaacga cctggtgctg       720
     agcctggaca tgcgcctgca aagcctggct taccgggcgc tgaagaaagc cacccagtac       780
     catatggcca cctccggttc actggtgatc atcgatatcc ccaccggtga aatcctggcc       840
     atggccaaca cccccagctt taaccccaac cagcgcagcg gcatccaggc ataccagatg       900
     cgtaaccgcg ccatcaccga cgcctatgaa ccgggctccg tggtgaagcc gctggtggtg       960
     gctgccgcca tggagaaggg gctggtgacc ccggataccg tgatggacac cagtccgggt      1020
     tggatgcgcg tcagcggtgg tctggtgcgg gatacccgaa acttcggtaa gcaggacgtc      1080
     acccacctgc tggtgaaatc ctccaacatc ggtatggcca agatggcgct gcagatggag      1140
     gtggacgaat tgctggcctt ctacgccgac tttggccttg gcacctacag cggcatcaac      1200
     ctggatgggg aaaccaccgg taacgtgccc aagcgccgcc gctggtctga gcatgagcgc      1260
     gccaccctgg cctttggcta cggtctgacc tccacgccgc tgcagttggc ccggatgtac      1320
     gccattcttg gcgccaacgg cgtggcccgc ccggcgtcga ttctgaaact gcgtgacggt      1380
     caggtaccgg aaggggaaca ggtgttgtct cccaaggtgg ccaagcagat gttggcgata      1440
     ttgactcagg tgaccgagcc cggtggcacc gctacccgcg cggcgatcga tggctacaag      1500
     gtggcgggga aaaccggcac cagccggaaa gcggtggccg ggggctacgg tgaagattac      1560
     gtctctctgt tcgctggcct ggcgccgtcg gacaatcccc gcctggcgat ggcggtggtg      1620
     attaacgagc cacagggcga cgcctactac ggcggtgtgg tggcggcgcc ggtgttctct      1680
     gaagtgatgg ccggggccct gcaattattg aatgtggaac caagccagcg cagtcccgaa      1740
     ctgggcacgc tggcctcagt atgggggagc gataatgtcg tcactcgatg a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page