(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE344

CP002209.PE344       Location/Qualifiers
FT   CDS_pept        377594..378895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0344"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="COGs: COG0771
FT                   UDP-N-acetylmuramoylalanine-D-glutamate ligase; InterPro
FT                   IPR004101: IPR013221: IPR006162: IPR005762; KEGG:
FT                   spl:Spea_3813 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; SPTR: A2UXQ8
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase family, glutamate ligase domain; Mur ligase middle
FT                   domain; TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74558"
FT                   /db_xref="GOA:E1SMK3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK3"
FT                   /protein_id="ADN74558.1"
FT                   /translation="MTTPAPHTWILGLGITGLSVVRHLAAESESLAVWDSRANPPGADT
FT                   LARDFAHVALQTGPFDGDVLAQAKRLVVSPGIDLRTPALAQAIAAGVEVVGDIELFARA
FT                   ADAPVVAITGSNGKSTVTTLVGHLAQACGVSVGVGGNIGTPALDLLGQGHQLYVLELSS
FT                   FQLETTRSLPAQVGTVLNVSPDHLDRYDSYEAYRDAKLALYPQCRIALFNRADHNTLPS
FT                   SHPRTLSFGPDAPDGDNFGVVGDWLMQGQTRLKRRDQLTLVGAHNEQNVLAALALGQAA
FT                   GLEMDAMLSALDSYRGLPHRCELVAERAGVRYVNDSKATNLGATQAALDGLELGRVWLI
FT                   AGGDAKGQDLSVLAPALNQLAGLITLGQDGPAIAALRSDATEVVSIESAVAVAADQARA
FT                   GDIVLLSPACSSLDMFASFEQRGECFAAAARGLR"
     atgacgacac cggcccccca cacctggatc cttggcctcg gcatcaccgg cctcagtgtg        60
     gttcgccacc tggccgctga gtccgagtcg ctggcggtgt gggacagccg cgcaaaccct       120
     cccggagccg ataccctggc ccgggatttt gcccatgtgg ccttgcaaac cggcccgttt       180
     gatggtgacg tcctggctca ggccaagcgg ttggtagtga gccccgggat tgacctgcgc       240
     acgcccgctc tggctcaggc cattgccgcc ggggttgagg tggtgggcga catcgaactg       300
     tttgcccggg cggccgatgc accggtggtg gccatcaccg gctccaacgg caaatccacc       360
     gtaaccaccc tggttgggca cctggcccaa gcctgcggcg tgtcggtggg cgttggcggc       420
     aatattggca cccctgcgct ggacctgctg ggtcaggggc atcagctgta tgtgctggaa       480
     ctgtccagct tccagctgga gaccacccgc tcattgccgg cgcaggtggg caccgtactg       540
     aatgtcagcc cggaccacct cgaccgttac gacagctacg aagcctatcg tgacgccaaa       600
     ctggcgctct atccgcagtg ccggatcgcc ctgttcaatc gcgccgacca caacaccctg       660
     ccgtcatcgc acccccgcac cctgagcttc ggcccggatg cgccggacgg tgacaacttc       720
     ggtgtggttg gggattggct gatgcagggt cagacccggc tgaaacgccg tgaccagctc       780
     acgctggtag gcgcacacaa cgaacagaac gtgctggcgg cgctggcgct gggtcaggct       840
     gccggactgg agatggacgc catgctgtcc gcgctggaca gctaccgtgg cctgccgcac       900
     cgctgtgaac tggtggcgga gcgtgcgggg gttcgctacg tcaacgattc caaagcgacc       960
     aacctcggtg ccactcaggc ggcgctggac gggttggagc tgggtcgggt ctggttgatc      1020
     gctggtggcg acgccaaggg ccaggatctg tcggtgctgg caccggcgct gaatcaactg      1080
     gcaggcctga tcacgctggg gcaggatggc cccgccattg cggcgctgcg cagcgatgcc      1140
     accgaggtgg tgagcatcga gtcggcggtg gccgttgccg ctgaccaggc ccgcgccggt      1200
     gacattgtgt tgctgtcgcc cgcctgctcc agtctcgata tgttcgccag ctttgaacag      1260
     cgcggtgagt gttttgccgc tgcggcacgg gggctgcggt ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page