(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE346

CP002209.PE346       Location/Qualifiers
FT   CDS_pept        380105..381190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0346"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="COGs: COG0707 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase; InterPro IPR004276:
FT                   IPR007235: IPR006009; KEGG: slo:Shew_3453
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; PFAM: glycosyl
FT                   transferase family 28; Glycosyltransferase 28 domain;
FT                   PRIAM: Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; SPTR: A3QIM1
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase;
FT                   TIGRFAM:UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase; PFAM: Glycosyltransferase
FT                   family 28 N-terminal domain; Glycosyltransferase family 28
FT                   C-terminal domain; TIGRFAM:
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74560"
FT                   /db_xref="GOA:E1SMK5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E1SMK5"
FT                   /protein_id="ADN74560.1"
FT                   /translation="MSDNKAPRLMVMAGGTGGHVFPALAVARRLRQQGWEVLWLGTAER
FT                   MEARLVPQHGFAIRFIDIKGVRGNGLLRKLKAPFQIFKAIAQARRIQAEFQPDVVMGMG
FT                   GYAAGPGGIAAWLRRTPLVLHEQNAVAGATNAILAKFANKVLVAFDNVLPGEQRVGNPV
FT                   RDELVAIGETQPVVPGEQLKVLVVGGSLGAQVLNDQVPAAVGRLANEAAVTVWHQVGRG
FT                   NEAAVTQRWAEMAPGVGAQVTEFIDDMAAAYAWADLVICRAGALTVAELAATGRPSLLV
FT                   PFPHAVDDHQTKNAEALVAAGAARLLPQASLTPERLADEMLTLVQQPDTLVQMAEAARN
FT                   SAILDATDKVAGICASLARRD"
     atgagtgaca ataaggcgcc tcgcttgatg gtgatggcgg gcggcaccgg aggacacgtg        60
     ttcccggctc tggccgtggc ccgacgcctg cgccagcagg gttgggaagt gctgtggctt       120
     ggcaccgccg aacggatgga ggcgcgactg gtgccccagc atgggtttgc catccgcttt       180
     atcgacatta aaggggtacg gggcaatggc ttgctgcgca agttgaaagc cccgttccag       240
     atctttaagg cgatcgctca ggcccgccgc attcaggcgg agttccagcc cgatgtggtg       300
     atgggcatgg ggggctacgc cgccggcccg ggtggcattg cagcgtggct gcgccgtacc       360
     ccgctggtac tgcatgagca aaatgcggtg gccggtgcca ccaacgcgat cctggccaag       420
     tttgccaaca aggttctggt ggcgttcgac aacgtgctgc cgggtgagca gcgggtgggc       480
     aacccggtgc gcgacgagtt ggtggcgatt ggggaaaccc agcctgtggt gcccggtgag       540
     caactgaaag tgctggtggt gggcggcagc cttggcgccc aggtgctgaa cgatcaggtg       600
     cctgcagcgg ttggccgtct ggccaatgag gcggcggtga ccgtgtggca tcaggtcggc       660
     cgtggcaacg aagctgccgt gacgcaacgc tgggccgaga tggcgccggg cgttggcgcc       720
     caggtgaccg aatttattga tgatatggcg gcggcttacg cctgggctga cctggtgatt       780
     tgccgggccg gagccctgac cgtcgctgaa ctggcggcca ccggacggcc gtctctgttg       840
     gtgccgttcc cccatgcggt ggacgaccat cagaccaaaa acgccgaagc cctggtggcg       900
     gcgggtgcgg cccgcctgtt accccaggcc agcctgaccc cagagcgtct ggctgacgag       960
     atgctgaccc tggtgcaaca gcctgacacg ctggtgcaga tggccgaggc agcacgcaac      1020
     agcgccatcc tggatgccac cgacaaagtg gccgggatct gcgcttcact ggcacggaga      1080
     gattga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page